Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>MF694941.1 | internal | 184 | 2-553(+) |
Amino Acid sequence : | |||
GVGFKAGVKDYKLTYYTPEYETKDTDILAAFRVTPQPGVPPEEAGAAVAAESSTGTWTTVWTDGLTSLDRYKGRCYHIEPVVGEQNQYIAYVAYPLDLFEEGSVTNMFTSIVGNVFGFKA LRALRLEDLRIPPAYSKTFQGPPHGIQVERDKLNKYGRPLLGCTIKPKLGLSAKNYGRAVYECL | |||
Physicochemical properties | |||
Number of amino acids: | 184 | ||
Molecular weight: | 20,353.920 | ||
Theoretical pI: | 7.826 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 30370 30495 | ||
Instability index: | 28.251 | ||
aromaticity | 0.120 | ||
GRAVY | -0.296 | ||
Secondary Structure Fraction | |||
Helix | 0.321 | ||
turn | 0.234 | ||
sheet | 0.239 |