| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >MF966956.1 | complete | 495 | 1-1488(+) |
Amino Acid sequence : | |||
| MAGTSEPLLHDSQLSSITAAGDIEKVRGCRDFWREFCVESRKLWYLAGPAIFTSVCQYSLGAVTQMLVGQVGTLELAAVSVENSVVAGFSFGIMLGMGSALETLCGQAYGAGQLDMLGVY MQRSWVILNSTSVLLSLLYIFAGPILRFIGQPPDIADMAGKLSIWMIPQLFAYSMNFPTAKFLQAQSKMTVMAAIAVAALAFHALFSWLLILKLNWGLAGAAVVLNASWWLIVGAQLVYI FGGSCGRTWTGFSWKAFHNLWSFVRLSLSSAVMLCLEMWYYTALIMFAGYLKNAEVSVDGLSICMNIYGWAVMVAIGSNAATSVRVSNELGAGHPRTAKFSVVVVVITSFLIGVILSLVL LIARKQYPSVFSNSEEVKKLVYELTPLLATSIVVSNVQPVLSGVAIGAGWQALVAYINIGSYYAFGIPLGLLLGYKFDLGVQGIWYGMLAGTVLQTLILFWITYRTDWNKEASIAGERIK TWGGDTEDKGYEIEK* | |||
Physicochemical properties | |||
| Number of amino acids: | 495 | ||
| Molecular weight: | 11,543.452 | ||
| Theoretical pI: | 9.664 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 11460 11835 | ||
| Instability index: | 74.577 | ||
| aromaticity | 0.079 | ||
| GRAVY | -0.285 | ||
Secondary Structure Fraction | |||
| Helix | 0.287 | ||
| turn | 0.248 | ||
| sheet | 0.248 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >MF966956.1 | complete | 203 | 165-776(+) |
Amino Acid sequence : | |||
| MPIFSRRGHADACGPGRHARACGRLGGEFGGRRLFLWNHVGHGERTGNSMRAGIRSRATGHARSVHATFMGDPKLNLSPTKPPLHLRGPHPPVHRTAARHSRHGRKALHMDDPAALRLLH ELPDRKVLAGAEQDDGDGSDRGGGIGVPRTLQLAPDFEAQLGVGRCRGRAERVVVAHCGRTAGVHFWRIVRENVDRVFLEGVS* | |||
Physicochemical properties | |||
| Number of amino acids: | 203 | ||
| Molecular weight: | 11,543.452 | ||
| Theoretical pI: | 9.664 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 11460 11835 | ||
| Instability index: | 74.577 | ||
| aromaticity | 0.079 | ||
| GRAVY | -0.285 | ||
Secondary Structure Fraction | |||
| Helix | 0.287 | ||
| turn | 0.248 | ||
| sheet | 0.248 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >MF966956.1 | complete | 123 | 774-403(-) |
Amino Acid sequence : | |||
| MKRLPRKPGPRSPARSSKNVHQLCAHNEPPRRVQHDRGTGQPPIELQNQEPAEECVERQCRHRDRCHHRHLALRLQELCGREVHGVGEELRDHPYGELSGHVCYVGRLSDEPEDGAREDV EEA* | |||
Physicochemical properties | |||
| Number of amino acids: | 123 | ||
| Molecular weight: | 11,543.452 | ||
| Theoretical pI: | 9.664 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 11460 11835 | ||
| Instability index: | 74.577 | ||
| aromaticity | 0.079 | ||
| GRAVY | -0.285 | ||
Secondary Structure Fraction | |||
| Helix | 0.287 | ||
| turn | 0.248 | ||
| sheet | 0.248 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >MF966956.1 | 3prime_partial | 120 | 362-3(-) |
Amino Acid sequence : | |||
| MYTPSMSSCPAPYACPHRVSSALPMPNMIPKEKPATTEFSTETAASSSVPTWPTSICVTAPREYWHTEVKMAGPARYQSFLDSTQNSLQKSRQPRTFSISPAAVIDDSWLSWRRGSLVPA | |||
Physicochemical properties | |||
| Number of amino acids: | 120 | ||
| Molecular weight: | 11,543.452 | ||
| Theoretical pI: | 9.664 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 11460 11835 | ||
| Instability index: | 74.577 | ||
| aromaticity | 0.079 | ||
| GRAVY | -0.285 | ||
Secondary Structure Fraction | |||
| Helix | 0.287 | ||
| turn | 0.248 | ||
| sheet | 0.248 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >MF966956.1 | 5prime_partial | 101 | 1486-1181(-) |
Amino Acid sequence : | |||
| TSLSRILYLPYPLPMSLFFPQQWKPLCSNRFGRLSRRGLVSATLYQLTCHTKCPVHLGQTCNPAGGQGECQMHNRNQCLYMQQVPAILLQLRRLKGQAEHC* | |||
Physicochemical properties | |||
| Number of amino acids: | 101 | ||
| Molecular weight: | 11,543.452 | ||
| Theoretical pI: | 9.664 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 11460 11835 | ||
| Instability index: | 74.577 | ||
| aromaticity | 0.079 | ||
| GRAVY | -0.285 | ||
Secondary Structure Fraction | |||
| Helix | 0.287 | ||
| turn | 0.248 | ||
| sheet | 0.248 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >MF966956.1 | complete | 495 | 1-1488(+) |
Amino Acid sequence : | |||
| MAGTSEPLLHDSQLSSITAAGDIEKVRGCRDFWREFCVESRKLWYLAGPAIFTSVCQYSLGAVTQMLVGQVGTLELAAVSVENSVVAGFSFGIMLGMGSALETLCGQAYGAGQLDMLGVY MQRSWVILNSTSVLLSLLYIFAGPILRFIGQPPDIADMAGKLSIWMIPQLFAYSMNFPTAKFLQAQSKMTVMAAIAVAALAFHALFSWLLILKLNWGLAGAAVVLNASWWLIVGAQLVYI FGGSCGRTWTGFSWKAFHNLWSFVRLSLSSAVMLCLEMWYYTALIMFAGYLKNAEVSVDGLSICMNIYGWAVMVAIGSNAATSVRVSNELGAGHPRTAKFSVVVVVITSFLIGVILSLVL LIARKQYPSVFSNSEEVKKLVYELTPLLATSIVVSNVQPVLSGVAIGAGWQALVAYINIGSYYAFGIPLGLLLGYKFDLGVQGIWYGMLAGTVLQTLILFWITYRTDWNKEASIAGERIK TWGGDTEDKGYEIEK* | |||
Physicochemical properties | |||
| Number of amino acids: | 495 | ||
| Molecular weight: | 11,543.452 | ||
| Theoretical pI: | 9.664 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 11460 11835 | ||
| Instability index: | 74.577 | ||
| aromaticity | 0.079 | ||
| GRAVY | -0.285 | ||
Secondary Structure Fraction | |||
| Helix | 0.287 | ||
| turn | 0.248 | ||
| sheet | 0.248 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >MF966956.1 | complete | 203 | 165-776(+) |
Amino Acid sequence : | |||
| MPIFSRRGHADACGPGRHARACGRLGGEFGGRRLFLWNHVGHGERTGNSMRAGIRSRATGHARSVHATFMGDPKLNLSPTKPPLHLRGPHPPVHRTAARHSRHGRKALHMDDPAALRLLH ELPDRKVLAGAEQDDGDGSDRGGGIGVPRTLQLAPDFEAQLGVGRCRGRAERVVVAHCGRTAGVHFWRIVRENVDRVFLEGVS* | |||
Physicochemical properties | |||
| Number of amino acids: | 203 | ||
| Molecular weight: | 11,543.452 | ||
| Theoretical pI: | 9.664 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 11460 11835 | ||
| Instability index: | 74.577 | ||
| aromaticity | 0.079 | ||
| GRAVY | -0.285 | ||
Secondary Structure Fraction | |||
| Helix | 0.287 | ||
| turn | 0.248 | ||
| sheet | 0.248 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >MF966956.1 | complete | 123 | 774-403(-) |
Amino Acid sequence : | |||
| MKRLPRKPGPRSPARSSKNVHQLCAHNEPPRRVQHDRGTGQPPIELQNQEPAEECVERQCRHRDRCHHRHLALRLQELCGREVHGVGEELRDHPYGELSGHVCYVGRLSDEPEDGAREDV EEA* | |||
Physicochemical properties | |||
| Number of amino acids: | 123 | ||
| Molecular weight: | 11,543.452 | ||
| Theoretical pI: | 9.664 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 11460 11835 | ||
| Instability index: | 74.577 | ||
| aromaticity | 0.079 | ||
| GRAVY | -0.285 | ||
Secondary Structure Fraction | |||
| Helix | 0.287 | ||
| turn | 0.248 | ||
| sheet | 0.248 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >MF966956.1 | 3prime_partial | 120 | 362-3(-) |
Amino Acid sequence : | |||
| MYTPSMSSCPAPYACPHRVSSALPMPNMIPKEKPATTEFSTETAASSSVPTWPTSICVTAPREYWHTEVKMAGPARYQSFLDSTQNSLQKSRQPRTFSISPAAVIDDSWLSWRRGSLVPA | |||
Physicochemical properties | |||
| Number of amino acids: | 120 | ||
| Molecular weight: | 11,543.452 | ||
| Theoretical pI: | 9.664 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 11460 11835 | ||
| Instability index: | 74.577 | ||
| aromaticity | 0.079 | ||
| GRAVY | -0.285 | ||
Secondary Structure Fraction | |||
| Helix | 0.287 | ||
| turn | 0.248 | ||
| sheet | 0.248 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >MF966956.1 | 5prime_partial | 101 | 1486-1181(-) |
Amino Acid sequence : | |||
| TSLSRILYLPYPLPMSLFFPQQWKPLCSNRFGRLSRRGLVSATLYQLTCHTKCPVHLGQTCNPAGGQGECQMHNRNQCLYMQQVPAILLQLRRLKGQAEHC* | |||
Physicochemical properties | |||
| Number of amino acids: | 101 | ||
| Molecular weight: | 11,543.452 | ||
| Theoretical pI: | 9.664 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 11460 11835 | ||
| Instability index: | 74.577 | ||
| aromaticity | 0.079 | ||
| GRAVY | -0.285 | ||
Secondary Structure Fraction | |||
| Helix | 0.287 | ||
| turn | 0.248 | ||
| sheet | 0.248 | ||