Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>MF979112.1 | internal | 170 | 1-510(+) |
Amino Acid sequence : | |||
VVHARGASAKGFFEVTHDISQLSCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPRGFAVKFYTREGNFDLVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRILDFFSHHPES CHMFTFLFDDLGVPQDYRHMDGSGVNTYTLVNKAGKAHYVKFHWKTTSGV | |||
Physicochemical properties | |||
Number of amino acids: | 170 | ||
Molecular weight: | 13,853.540 | ||
Theoretical pI: | 5.530 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 16500 16625 | ||
Instability index: | 37.984 | ||
aromaticity | 0.066 | ||
GRAVY | -0.581 | ||
Secondary Structure Fraction | |||
Helix | 0.254 | ||
turn | 0.295 | ||
sheet | 0.230 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>MF979112.1 | 3prime_partial | 122 | 366-1(-) |
Amino Acid sequence : | |||
MTTLRMVGEEVEDPPVFLDMRLGVGLKCMNHVWKLHSVPDEEHWEIVSHKIKVSFPGVEFDSKPTRIPQSFRASTFMDNSRESNNNWSLNTRGSKEVSTGELRDIMGNLKETLCTSSPGM DN | |||
Physicochemical properties | |||
Number of amino acids: | 122 | ||
Molecular weight: | 13,853.540 | ||
Theoretical pI: | 5.530 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 16500 16625 | ||
Instability index: | 37.984 | ||
aromaticity | 0.066 | ||
GRAVY | -0.581 | ||
Secondary Structure Fraction | |||
Helix | 0.254 | ||
turn | 0.295 | ||
sheet | 0.230 |