Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>MG224103.1 | internal | 172 | 2-517(+) |
Amino Acid sequence : | |||
LTYYTPEYETKDTDILAAFRVTPQPGVPPEEAGAAVAAESSTGTWTTVWTDGLTSLDRYKGRCYHIEPVPGEKDQYICYVAYPLDLFEEGSVTNMFTSIVGNVFGFKALRALRLEDLRIP VAYVKTFQGPPHGIQVERDKLNKYGRPLLGCTIKPKLGLSAKNYGRAVYECL | |||
Physicochemical properties | |||
Number of amino acids: | 172 | ||
Molecular weight: | 19,148.621 | ||
Theoretical pI: | 6.180 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 28880 29130 | ||
Instability index: | 31.198 | ||
aromaticity | 0.116 | ||
GRAVY | -0.258 | ||
Secondary Structure Fraction | |||
Helix | 0.326 | ||
turn | 0.221 | ||
sheet | 0.244 |