Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>MG225043.1 | internal | 259 | 1-777(+) |
Amino Acid sequence : | |||
SSLHLLRVFLNEYWNWNSFLTPKKVSFSLSKRNQRLFFFLYNSHVCEYESIFVFLRNQSFHLRSTSSGVLLERIYFYIKIERLMNVFVKDFRANLWLVEEPCMHYIRYQRKSILASKGTS LFMNKWKLNLVTFWQWHFSVWFHPRRIWINQFPKHSLEILGYLSNVQMNPSVVRSQILENSFLINNAIKKLDTLVPIIPLIAELAKAKFCNVLGHPISKPIRAELSDSNIIDRFSRICRN ISHYHSGSCKKRSLYRIKY | |||
Physicochemical properties | |||
Number of amino acids: | 259 | ||
Molecular weight: | 31,049.972 | ||
Theoretical pI: | 10.098 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 60390 60640 | ||
Instability index: | 46.603 | ||
aromaticity | 0.151 | ||
GRAVY | -0.105 | ||
Secondary Structure Fraction | |||
Helix | 0.413 | ||
turn | 0.239 | ||
sheet | 0.205 |