Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>MG251284.1 | internal | 243 | 1-729(+) |
Amino Acid sequence : | |||
DASSLHLLRFFLHEYCSLITSKKPGYSFSKKTQRFFFFLYNSYVYECESTFVFLRNQSSHLRSTSFGALLERIYFYGKIERLVEVFAKHFQVTLWLFKDPFIHYVRYEGKSILASKGTFL LMNKWKFYLVNFWQCHFSMYFHTGRIHINQLSNHSRDFMGYLSSVRLNHSMVRSQMLENSFLINNPIKKFDTLVPIIPLIGSLAKAHFCTVLGHPISKPVWSDLSDSDIIDRFGRICRNL FHY | |||
Physicochemical properties | |||
Number of amino acids: | 243 | ||
Molecular weight: | 28,858.145 | ||
Theoretical pI: | 9.599 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 41370 41620 | ||
Instability index: | 35.496 | ||
aromaticity | 0.177 | ||
GRAVY | -0.032 | ||
Secondary Structure Fraction | |||
Helix | 0.407 | ||
turn | 0.226 | ||
sheet | 0.193 |