| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >MG256297.1 | internal | 100 | 1-300(+) |
Amino Acid sequence : | |||
| FDAVAPDAFGLRARLPGRHASRRPLPFPHGFGYGTDNGFPLARLAQKGSLIDGCHNQWWLKDHWCCCASPCRLLGHRHKLTACNAPSTATPGQTGLPAEF | |||
Physicochemical properties | |||
| Number of amino acids: | 100 | ||
| Molecular weight: | 10,892.305 | ||
| Theoretical pI: | 9.151 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 17990 18365 | ||
| Instability index: | 52.737 | ||
| aromaticity | 0.100 | ||
| GRAVY | -0.361 | ||
Secondary Structure Fraction | |||
| Helix | 0.230 | ||
| turn | 0.280 | ||
| sheet | 0.240 | ||