Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>MG256297.1 | internal | 100 | 1-300(+) |
Amino Acid sequence : | |||
FDAVAPDAFGLRARLPGRHASRRPLPFPHGFGYGTDNGFPLARLAQKGSLIDGCHNQWWLKDHWCCCASPCRLLGHRHKLTACNAPSTATPGQTGLPAEF | |||
Physicochemical properties | |||
Number of amino acids: | 100 | ||
Molecular weight: | 10,892.305 | ||
Theoretical pI: | 9.151 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 17990 18365 | ||
Instability index: | 52.737 | ||
aromaticity | 0.100 | ||
GRAVY | -0.361 | ||
Secondary Structure Fraction | |||
Helix | 0.230 | ||
turn | 0.280 | ||
sheet | 0.240 |