Acc_NO	ORF type	length	start-end position (strand +/-)
>MG431129.1	internal	101	1-303(+)
Amino Acid sequence :
LGTMGEYGTPNIDIEEGYITITHNGRTDTLPYPKQASSFYHLSKVHDSNNIAFTCKAWGIRATDLNQGVVYGVRTDETEMHEELLNRFDYDGVFGTALNRF
Physicochemical properties
Number of amino acids:		101
Molecular weight:		11,407.461
Theoretical pI:		4.980
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines-		14440 14440
Instability index:		43.662
aromaticity		0.119
GRAVY		-0.515
Secondary Structure Fraction
Helix		0.297
turn		0.238
sheet		0.208