Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>MG548814.1 | internal | 145 | 3-437(+) |
Amino Acid sequence : | |||
CELQNPVNHRVFERKLRPKPVRPRARLPGCHASLPPPHKPPRGKVSGPGGDWPPVRCPLAVGPNPSLSATEPRRSVVRTSLSSSSRAPASPCQGLADPLHALWAMLASRPXVRRDYPLSL SISISGGKETYQDSPSNGERTGKSP | |||
Physicochemical properties | |||
Number of amino acids: | 145 | ||
Molecular weight: | 15,488.538 | ||
Theoretical pI: | 10.847 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 13980 14230 | ||
Instability index: | 65.947 | ||
aromaticity | 0.035 | ||
GRAVY | -0.698 | ||
Secondary Structure Fraction | |||
Helix | 0.201 | ||
turn | 0.403 | ||
sheet | 0.201 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>MG548814.1 | internal | 145 | 3-437(+) |
Amino Acid sequence : | |||
CELQNPVNHRVFERKLRPKPVRPRARLPGCHASLPPPHKPPRGKVSGPGGDWPPVRCPLAVGPNPSLSATEPRRSVVRTSLSSSSRAPASPCQGLADPLHALWAMLASRPXVRRDYPLSL SISISGGKETYQDSPSNGERTGKSP | |||
Physicochemical properties | |||
Number of amino acids: | 145 | ||
Molecular weight: | 15,488.538 | ||
Theoretical pI: | 10.847 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 13980 14230 | ||
Instability index: | 65.947 | ||
aromaticity | 0.035 | ||
GRAVY | -0.698 | ||
Secondary Structure Fraction | |||
Helix | 0.201 | ||
turn | 0.403 | ||
sheet | 0.201 |