| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >MG548814.1 | internal | 145 | 3-437(+) |
Amino Acid sequence : | |||
| CELQNPVNHRVFERKLRPKPVRPRARLPGCHASLPPPHKPPRGKVSGPGGDWPPVRCPLAVGPNPSLSATEPRRSVVRTSLSSSSRAPASPCQGLADPLHALWAMLASRPXVRRDYPLSL SISISGGKETYQDSPSNGERTGKSP | |||
Physicochemical properties | |||
| Number of amino acids: | 145 | ||
| Molecular weight: | 15,488.538 | ||
| Theoretical pI: | 10.847 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 13980 14230 | ||
| Instability index: | 65.947 | ||
| aromaticity | 0.035 | ||
| GRAVY | -0.698 | ||
Secondary Structure Fraction | |||
| Helix | 0.201 | ||
| turn | 0.403 | ||
| sheet | 0.201 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >MG548814.1 | internal | 145 | 3-437(+) |
Amino Acid sequence : | |||
| CELQNPVNHRVFERKLRPKPVRPRARLPGCHASLPPPHKPPRGKVSGPGGDWPPVRCPLAVGPNPSLSATEPRRSVVRTSLSSSSRAPASPCQGLADPLHALWAMLASRPXVRRDYPLSL SISISGGKETYQDSPSNGERTGKSP | |||
Physicochemical properties | |||
| Number of amino acids: | 145 | ||
| Molecular weight: | 15,488.538 | ||
| Theoretical pI: | 10.847 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 13980 14230 | ||
| Instability index: | 65.947 | ||
| aromaticity | 0.035 | ||
| GRAVY | -0.698 | ||
Secondary Structure Fraction | |||
| Helix | 0.201 | ||
| turn | 0.403 | ||
| sheet | 0.201 | ||