Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>MG748839.1 | internal | 195 | 2-586(+) |
Amino Acid sequence : | |||
STFVFLRNQSSHLRSTSFGALLERIYFYGKIERLVEVFAKDFQVTLWLFKDPFIHYVRYEGKSILASKGTFLLMNKWKFYLVNFWQCHFSMYFHTGRIHINQLSNHSRDFMGYLSSVRLN HSMVRSQMLENSFLINNPIKKFDTLVPIIPLIGSLAKAHFCTVLGHPISKPVWSDLSDSDIIDRFGRICRNLFHY | |||
Physicochemical properties | |||
Number of amino acids: | 195 | ||
Molecular weight: | 23,011.497 | ||
Theoretical pI: | 9.709 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 33920 34045 | ||
Instability index: | 38.683 | ||
aromaticity | 0.159 | ||
GRAVY | 0.008 | ||
Secondary Structure Fraction | |||
Helix | 0.405 | ||
turn | 0.231 | ||
sheet | 0.190 |