Acc_NO	ORF type	length	start-end position (strand +/-)
>MG748839.1	internal	195	2-586(+)
Amino Acid sequence :
STFVFLRNQSSHLRSTSFGALLERIYFYGKIERLVEVFAKDFQVTLWLFKDPFIHYVRYEGKSILASKGTFLLMNKWKFYLVNFWQCHFSMYFHTGRIHINQLSNHSRDFMGYLSSVRLN HSMVRSQMLENSFLINNPIKKFDTLVPIIPLIGSLAKAHFCTVLGHPISKPVWSDLSDSDIIDRFGRICRNLFHY
Physicochemical properties
Number of amino acids:		195
Molecular weight:		23,011.497
Theoretical pI:		9.709
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines-		33920 34045
Instability index:		38.683
aromaticity		0.159
GRAVY		0.008
Secondary Structure Fraction
Helix		0.405
turn		0.231
sheet		0.190