| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >MG815796.1 | 5prime_partial | 160 | 1-483(+) |
Amino Acid sequence : | |||
| VAIEKLMGTNAEIRLIKPSKSIILPKYGSGSDLTKNSKFSNGRNCVPEYCIVAFQQPKCSYRKANGDPCGGSFDKAFQIDYFAKIRKWLGFVKKTPNFRMVVTVCPNIVLRRFSSQNVAI GKIMRTNVKIRLIKPSKSIILPKYGNGCDLTKKLQIFEWS* | |||
Physicochemical properties | |||
| Number of amino acids: | 160 | ||
| Molecular weight: | 18,057.175 | ||
| Theoretical pI: | 10.061 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 18450 18825 | ||
| Instability index: | 24.256 | ||
| aromaticity | 0.100 | ||
| GRAVY | -0.211 | ||
Secondary Structure Fraction | |||
| Helix | 0.325 | ||
| turn | 0.269 | ||
| sheet | 0.150 | ||