| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >MG815798.1 | 5prime_partial | 163 | 507-16(-) |
Amino Acid sequence : | |||
| ATIRYSGTQLRPFENLEFFVKSKPLPYFGKIIDLEGFIKRFSTLAPISFPIATFWLLERLNTIFGHTVTTIRKSGVFVKSQPLPYFGKIIDLEGFIKQTSTLVPISFSVATFWLLERHNT IFGHTVTTIRKFGVFCQIATTSVFWQNNRFGSLYQMNLRIGPH* | |||
Physicochemical properties | |||
| Number of amino acids: | 163 | ||
| Molecular weight: | 14,134.441 | ||
| Theoretical pI: | 9.755 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 9970 10220 | ||
| Instability index: | 44.977 | ||
| aromaticity | 0.062 | ||
| GRAVY | 0.046 | ||
Secondary Structure Fraction | |||
| Helix | 0.333 | ||
| turn | 0.318 | ||
| sheet | 0.155 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >MG815798.1 | 5prime_partial | 159 | 1-480(+) |
Amino Acid sequence : | |||
| VAIEKLMGTNAEIHLIKASKSIILPKYGSGCDLTKNSKFSNGRNCVPEYRIVAFQQPKRRYRKANRDQCGGLFDKAFQIDYFSKIRKWLRFDKNSRFSNGRNCVPEYRIEAFQQPKRSYR KANGGQCGESFDKSFQIDYFAKIRKWFRFDKKLQIFEWS* | |||
Physicochemical properties | |||
| Number of amino acids: | 159 | ||
| Molecular weight: | 14,134.441 | ||
| Theoretical pI: | 9.755 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 9970 10220 | ||
| Instability index: | 44.977 | ||
| aromaticity | 0.062 | ||
| GRAVY | 0.046 | ||
Secondary Structure Fraction | |||
| Helix | 0.333 | ||
| turn | 0.318 | ||
| sheet | 0.155 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >MG815798.1 | 3prime_partial | 129 | 122-508(+) |
Amino Acid sequence : | |||
| MVVTVCPNIVLWRSSSQNVATEKLIGTNVEVCLIKPSKSIIFPKYGSGCDLTKTPDFRMVVTVCPNIVLRRSSSQNVAIGKLMGANVENRLINPSKSIILPKYGSGFDLTKNSKFSNGRN CVPEYRIVA | |||
Physicochemical properties | |||
| Number of amino acids: | 129 | ||
| Molecular weight: | 14,134.441 | ||
| Theoretical pI: | 9.755 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 9970 10220 | ||
| Instability index: | 44.977 | ||
| aromaticity | 0.062 | ||
| GRAVY | 0.046 | ||
Secondary Structure Fraction | |||
| Helix | 0.333 | ||
| turn | 0.318 | ||
| sheet | 0.155 | ||