| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >MG816110.1 | complete | 270 | 1-813(+) |
Amino Acid sequence : | |||
| MFQVINHSIPKEAIEELQSAGKHFFELSREEKESYGNGKAKWARSFEGYGTNIHKDSEGMKKAWSDFLFHNVWPPSVISYDVWPRNPSSYRKANEDYARNLLPVVDGILSSLSVGLGLEK NALKDASGGDDLEMLMKINHYPPCPRPDLALGVPAHTDMSAITVLVPNDIPGLQLFKDGRWFDINYVPGALIIHIGDQIEILSNGRYKAVLHRARVNKDNVRFSWPVFCSPPPEMVVGPL PQLVSEENPPKFKAKKYKDYQYCKMNKLPQ* | |||
Physicochemical properties | |||
| Number of amino acids: | 270 | ||
| Molecular weight: | 30,568.632 | ||
| Theoretical pI: | 7.715 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 49390 49515 | ||
| Instability index: | 52.630 | ||
| aromaticity | 0.104 | ||
| GRAVY | -0.460 | ||
Secondary Structure Fraction | |||
| Helix | 0.311 | ||
| turn | 0.285 | ||
| sheet | 0.230 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >MG816110.1 | complete | 270 | 1-813(+) |
Amino Acid sequence : | |||
| MFQVINHSIPKEAIEELQSAGKHFFELSREEKESYGNGKAKWARSFEGYGTNIHKDSEGMKKAWSDFLFHNVWPPSVISYDVWPRNPSSYRKANEDYARNLLPVVDGILSSLSVGLGLEK NALKDASGGDDLEMLMKINHYPPCPRPDLALGVPAHTDMSAITVLVPNDIPGLQLFKDGRWFDINYVPGALIIHIGDQIEILSNGRYKAVLHRARVNKDNVRFSWPVFCSPPPEMVVGPL PQLVSEENPPKFKAKKYKDYQYCKMNKLPQ* | |||
Physicochemical properties | |||
| Number of amino acids: | 270 | ||
| Molecular weight: | 30,568.632 | ||
| Theoretical pI: | 7.715 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 49390 49515 | ||
| Instability index: | 52.630 | ||
| aromaticity | 0.104 | ||
| GRAVY | -0.460 | ||
Secondary Structure Fraction | |||
| Helix | 0.311 | ||
| turn | 0.285 | ||
| sheet | 0.230 | ||