| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >MG816113.1 | complete | 559 | 1-1680(+) |
Amino Acid sequence : | |||
| MLVRINTLLQGYSGIRFEILEAITALLNSNITPCLPLRGTISASGDLVPLSYIAGLLTGRPNSKALGPTGTPIDASEAFELAGIPTGFFELQPKEGLALVNGTAVGSGLASTVLFETNVL AVMAEVLSAVFCEVMQGKPEYTDHLTHKLKHHPGQIEAAAIMEHVLEGSSYMKMAKKLHELDPLQKPKQDRYALRTSPQWLGPQIEVIRSATKSIQREINSVNDNPLIDVSRDKAVHGGN FQGTPIGVSMDNTRLAVAAIGKLMFAQFSELVNDFYNNGLPSNLSGGRDPSLDYGFKGAEIAMASYCSELQFLANPVTNHVQSAEQHNQDVNSLGLISSRKTAEAVEILKLMTATFLVGI CQAVDLRHLEENLRHAVKNTVSQVAKKVLTTGANGELHPSRFCEKDLIKAIDHECVFGYIDDPCSAAYPLMQKLRQVLVEHALVTITVTGEKGLGVSVFEKIAVFEKELRAVLPREVEAA RTAVEDGNAVISNRIKECRSYPLYRFVREELGTGFLTGEKVRSPGEEFDKVFVAICEGKAIDPLLECLKEWDGAPLPLS* | |||
Physicochemical properties | |||
| Number of amino acids: | 559 | ||
| Molecular weight: | 11,583.348 | ||
| Theoretical pI: | 10.297 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 23490 23615 | ||
| Instability index: | 45.902 | ||
| aromaticity | 0.055 | ||
| GRAVY | -0.023 | ||
Secondary Structure Fraction | |||
| Helix | 0.236 | ||
| turn | 0.327 | ||
| sheet | 0.255 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >MG816113.1 | 5prime_partial | 238 | 3-719(+) |
Amino Acid sequence : | |||
| AGQNQHPPPGLLRHPFRDPRSHHRPPQQQHHPLPPSPRHHLRLRRPRPPILHRRVANGPTQFQSPRPHRHPHRRLRSLRARRHSDRLLRIATQRGPRARQRDRRRVRSGLHRPLRDQRSR RNGRGPISGLLRGDARETRVHRPPHPQAQAPPGPNRGRRDHGTRARRKLLHENGEEAPRARSPPEAEAGPVRPPHVPAVAGPADRSDPVGDQVDPAGDQLGQRQPPDRRVEGQGRPRG* | |||
Physicochemical properties | |||
| Number of amino acids: | 238 | ||
| Molecular weight: | 11,583.348 | ||
| Theoretical pI: | 10.297 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 23490 23615 | ||
| Instability index: | 45.902 | ||
| aromaticity | 0.055 | ||
| GRAVY | -0.023 | ||
Secondary Structure Fraction | |||
| Helix | 0.236 | ||
| turn | 0.327 | ||
| sheet | 0.255 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >MG816113.1 | complete | 144 | 1080-1514(+) |
Amino Acid sequence : | |||
| MPGCRFAPPGGESETRGQEHGEPGGEEGPDDGSERGATPIPILREGSDQSDRSRVRVRVHRRSLQRRLSSDAEAETGSCRTRARYHYRYRREGIRGVRIRKDCGFREGVEGGSAERSGGG EDGGGGWQCRDIEQDKGVQVVSSV* | |||
Physicochemical properties | |||
| Number of amino acids: | 144 | ||
| Molecular weight: | 11,583.348 | ||
| Theoretical pI: | 10.297 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 23490 23615 | ||
| Instability index: | 45.902 | ||
| aromaticity | 0.055 | ||
| GRAVY | -0.023 | ||
Secondary Structure Fraction | |||
| Helix | 0.236 | ||
| turn | 0.327 | ||
| sheet | 0.255 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >MG816113.1 | complete | 110 | 485-153(-) |
Amino Acid sequence : | |||
| MIAAASIWPGWCLSLWVRWSVYSGFPCITSQKTADRTSAITARTLVSKRTVEARPDPTAVPLTSARPSLGCNSKKPVGMPASSKASEASMGVPVGPRALELGRPVSNPAM* | |||
Physicochemical properties | |||
| Number of amino acids: | 110 | ||
| Molecular weight: | 11,583.348 | ||
| Theoretical pI: | 10.297 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 23490 23615 | ||
| Instability index: | 45.902 | ||
| aromaticity | 0.055 | ||
| GRAVY | -0.023 | ||
Secondary Structure Fraction | |||
| Helix | 0.236 | ||
| turn | 0.327 | ||
| sheet | 0.255 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >MG816113.1 | complete | 559 | 1-1680(+) |
Amino Acid sequence : | |||
| MLVRINTLLQGYSGIRFEILEAITALLNSNITPCLPLRGTISASGDLVPLSYIAGLLTGRPNSKALGPTGTPIDASEAFELAGIPTGFFELQPKEGLALVNGTAVGSGLASTVLFETNVL AVMAEVLSAVFCEVMQGKPEYTDHLTHKLKHHPGQIEAAAIMEHVLEGSSYMKMAKKLHELDPLQKPKQDRYALRTSPQWLGPQIEVIRSATKSIQREINSVNDNPLIDVSRDKAVHGGN FQGTPIGVSMDNTRLAVAAIGKLMFAQFSELVNDFYNNGLPSNLSGGRDPSLDYGFKGAEIAMASYCSELQFLANPVTNHVQSAEQHNQDVNSLGLISSRKTAEAVEILKLMTATFLVGI CQAVDLRHLEENLRHAVKNTVSQVAKKVLTTGANGELHPSRFCEKDLIKAIDHECVFGYIDDPCSAAYPLMQKLRQVLVEHALVTITVTGEKGLGVSVFEKIAVFEKELRAVLPREVEAA RTAVEDGNAVISNRIKECRSYPLYRFVREELGTGFLTGEKVRSPGEEFDKVFVAICEGKAIDPLLECLKEWDGAPLPLS* | |||
Physicochemical properties | |||
| Number of amino acids: | 559 | ||
| Molecular weight: | 11,583.348 | ||
| Theoretical pI: | 10.297 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 23490 23615 | ||
| Instability index: | 45.902 | ||
| aromaticity | 0.055 | ||
| GRAVY | -0.023 | ||
Secondary Structure Fraction | |||
| Helix | 0.236 | ||
| turn | 0.327 | ||
| sheet | 0.255 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >MG816113.1 | 5prime_partial | 238 | 3-719(+) |
Amino Acid sequence : | |||
| AGQNQHPPPGLLRHPFRDPRSHHRPPQQQHHPLPPSPRHHLRLRRPRPPILHRRVANGPTQFQSPRPHRHPHRRLRSLRARRHSDRLLRIATQRGPRARQRDRRRVRSGLHRPLRDQRSR RNGRGPISGLLRGDARETRVHRPPHPQAQAPPGPNRGRRDHGTRARRKLLHENGEEAPRARSPPEAEAGPVRPPHVPAVAGPADRSDPVGDQVDPAGDQLGQRQPPDRRVEGQGRPRG* | |||
Physicochemical properties | |||
| Number of amino acids: | 238 | ||
| Molecular weight: | 11,583.348 | ||
| Theoretical pI: | 10.297 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 23490 23615 | ||
| Instability index: | 45.902 | ||
| aromaticity | 0.055 | ||
| GRAVY | -0.023 | ||
Secondary Structure Fraction | |||
| Helix | 0.236 | ||
| turn | 0.327 | ||
| sheet | 0.255 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >MG816113.1 | complete | 144 | 1080-1514(+) |
Amino Acid sequence : | |||
| MPGCRFAPPGGESETRGQEHGEPGGEEGPDDGSERGATPIPILREGSDQSDRSRVRVRVHRRSLQRRLSSDAEAETGSCRTRARYHYRYRREGIRGVRIRKDCGFREGVEGGSAERSGGG EDGGGGWQCRDIEQDKGVQVVSSV* | |||
Physicochemical properties | |||
| Number of amino acids: | 144 | ||
| Molecular weight: | 11,583.348 | ||
| Theoretical pI: | 10.297 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 23490 23615 | ||
| Instability index: | 45.902 | ||
| aromaticity | 0.055 | ||
| GRAVY | -0.023 | ||
Secondary Structure Fraction | |||
| Helix | 0.236 | ||
| turn | 0.327 | ||
| sheet | 0.255 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >MG816113.1 | complete | 110 | 485-153(-) |
Amino Acid sequence : | |||
| MIAAASIWPGWCLSLWVRWSVYSGFPCITSQKTADRTSAITARTLVSKRTVEARPDPTAVPLTSARPSLGCNSKKPVGMPASSKASEASMGVPVGPRALELGRPVSNPAM* | |||
Physicochemical properties | |||
| Number of amino acids: | 110 | ||
| Molecular weight: | 11,583.348 | ||
| Theoretical pI: | 10.297 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 23490 23615 | ||
| Instability index: | 45.902 | ||
| aromaticity | 0.055 | ||
| GRAVY | -0.023 | ||
Secondary Structure Fraction | |||
| Helix | 0.236 | ||
| turn | 0.327 | ||
| sheet | 0.255 | ||