Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>MG816117.1 | 3prime_partial | 155 | 1-465(+) |
Amino Acid sequence : | |||
MDQKVVVNFYPKCPQPDLTLGLKRHTDPGTITLLLQDQVGGLQATKDGGKTWITVQPVEGAFVVNLGDHGHFLSNGRFKNADHQAVVNSNSSRLSIATFQNPAPDAIVYPLAIREGEKAV MEEPITFAEMYRRKMSRDIELANLKKLAKMENQQV | |||
Physicochemical properties | |||
Number of amino acids: | 155 | ||
Molecular weight: | 17,216.524 | ||
Theoretical pI: | 7.872 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 9970 9970 | ||
Instability index: | 41.861 | ||
aromaticity | 0.065 | ||
GRAVY | -0.375 | ||
Secondary Structure Fraction | |||
Helix | 0.284 | ||
turn | 0.226 | ||
sheet | 0.252 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>MG816117.1 | 3prime_partial | 155 | 1-465(+) |
Amino Acid sequence : | |||
MDQKVVVNFYPKCPQPDLTLGLKRHTDPGTITLLLQDQVGGLQATKDGGKTWITVQPVEGAFVVNLGDHGHFLSNGRFKNADHQAVVNSNSSRLSIATFQNPAPDAIVYPLAIREGEKAV MEEPITFAEMYRRKMSRDIELANLKKLAKMENQQV | |||
Physicochemical properties | |||
Number of amino acids: | 155 | ||
Molecular weight: | 17,216.524 | ||
Theoretical pI: | 7.872 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 9970 9970 | ||
Instability index: | 41.861 | ||
aromaticity | 0.065 | ||
GRAVY | -0.375 | ||
Secondary Structure Fraction | |||
Helix | 0.284 | ||
turn | 0.226 | ||
sheet | 0.252 |