Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>MG821572.1 | internal | 245 | 2-736(+) |
Amino Acid sequence : | |||
EGCTALVTGGSRGIGYGIVEELANLGASVYTCSRNQKELDECLTQWRSKGFNVEASVCDLSSRSEREEFMKTVSNHFHGKLNILVNNAGIVIYKEAKDYTMEDYSHIMSINFEAAYHLSV LAHPFLKASERGNVVFISSISGASALPYEAVYGATKGAMDQLTRCLAFEWAKDNIRVNGVGPGVIATSMVEMTIQDPEQKENLDKLIDRCALRRMGEPKELAAVVAFLCFPAASYVTGQI IYVDG | |||
Physicochemical properties | |||
Number of amino acids: | 245 | ||
Molecular weight: | 26,826.248 | ||
Theoretical pI: | 5.320 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 25900 26275 | ||
Instability index: | 30.087 | ||
aromaticity | 0.086 | ||
GRAVY | -0.052 | ||
Secondary Structure Fraction | |||
Helix | 0.306 | ||
turn | 0.233 | ||
sheet | 0.286 |