Acc_NO	ORF type	length	start-end position (strand +/-)
>MG893899.1	complete	313	1-942(+)
Amino Acid sequence :
MEAIGVLMTCPMNNYLEQELDKRFKLFRYWTQPKQREFLAQHAESIRAVVGNATAGADAELIDALPKLEIVSSFSVGLDKVDLNKCKEKGIRVSNTPDVLTDDVADLAIGLMLAVLRRIC ECDKYVRRGAWKLGDFKLTTKFSGKRVGILGLGRIGLAVAERAEAFDCPISYYSRSKKANTNYTYYNSVVELASNSDILVVACALTPETTHIVNREVIDALGPKGVLINIGRGPHVDEAE LVSALVEGRLGGAGLDVFEKEPEVPEQLFGLENVVLLPHVGSGTVETRKAMADLVLGNLEAHFSSKPLLTPVV*
Physicochemical properties
Number of amino acids:		313
Molecular weight:		14,501.535
Theoretical pI:		10.530
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines-		6990 7115
Instability index:		38.417
aromaticity		0.051
GRAVY		0.191
Secondary Structure Fraction
Helix		0.283
turn		0.355
sheet		0.283

Acc_NO	ORF type	length	start-end position (strand +/-)
>MG893899.1	complete	138	509-93(-)
Amino Acid sequence :
MGQSNASALSATANPILPNPRMPTLLPLNLVVNLKSPNFHAPLLTYLSHSQIRLRTASINPIAKSATSSVSTSGVLETLIPFSLHLFKSTLSNPTLKLETISNFGSASISSASAPAVAFP TTARIDSACWARNSRCLG*
Physicochemical properties
Number of amino acids:		138
Molecular weight:		14,501.535
Theoretical pI:		10.530
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines-		6990 7115
Instability index:		38.417
aromaticity		0.051
GRAVY		0.191
Secondary Structure Fraction
Helix		0.283
turn		0.355
sheet		0.283