Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>MG893900.1 | complete | 313 | 1-942(+) |
Amino Acid sequence : | |||
MEAIGVLMTCPMNNYLEQELDKRFKLFRYWTQPKQREFLAQHAESIRAVVGNATAGADAELIDALPKLEIVSSFSVGLDKVDLNKCKEKGIRVSNTPDVLTDDVADLAIGLMLAVLRRIC ECDKYVRRGAWKLGDFKLPTKFSGKRVGILGLGRIGLAAAERAEAFDCPISYYSRSKKANTNYTYYNSVVELASNSDILVVACALTPETTYIVNREVIDALGPKGVLINIGRGPHVDEAE LVSALVEGRLGGAGLDVFEKEPEVPEQLFGLENVVLLPHVGSGTVETRKAMADLVLGNLEAHFSSKPLLTPVV* | |||
Physicochemical properties | |||
Number of amino acids: | 313 | ||
Molecular weight: | 14,472.458 | ||
Theoretical pI: | 10.930 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 6990 7115 | ||
Instability index: | 40.370 | ||
aromaticity | 0.051 | ||
GRAVY | 0.115 | ||
Secondary Structure Fraction | |||
Helix | 0.268 | ||
turn | 0.362 | ||
sheet | 0.283 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>MG893900.1 | complete | 138 | 509-93(-) |
Amino Acid sequence : | |||
MGQSNASARSAAANPILPNPRMPTLLPLNLVGNLKSPNFHAPLLTYLSHSQIRLRTASINPIAKSATSSVSTSGVLETLIPFSLHLFKSTLSNPTLKLETISNFGSASISSASAPAVAFP TTARIDSACWARNSRCLG* | |||
Physicochemical properties | |||
Number of amino acids: | 138 | ||
Molecular weight: | 14,472.458 | ||
Theoretical pI: | 10.930 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 6990 7115 | ||
Instability index: | 40.370 | ||
aromaticity | 0.051 | ||
GRAVY | 0.115 | ||
Secondary Structure Fraction | |||
Helix | 0.268 | ||
turn | 0.362 | ||
sheet | 0.283 |