Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>MH069738.1 | internal | 201 | 1-603(+) |
Amino Acid sequence : | |||
YKLTYYTPEYETKDTDILAAFRVTPQPGVPPEEAGAAVAAESSTGTWTTVWTDGLTSLDRYKGRCYHIEPVVGEQNQYIAYVAYPLDLFEEGSVTNMFTSIVGNVFGFKALRALRLEDLR IPPAYSKTFQGPPHGIQVERDKLNKYGRPLLGCTIKPKLGLSAKNYGRAVYECLRGGLDFTKDDENVNSQPFMRWRDRFLF | |||
Physicochemical properties | |||
Number of amino acids: | 201 | ||
Molecular weight: | 22,724.479 | ||
Theoretical pI: | 6.932 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 35870 35995 | ||
Instability index: | 33.770 | ||
aromaticity | 0.129 | ||
GRAVY | -0.421 | ||
Secondary Structure Fraction | |||
Helix | 0.318 | ||
turn | 0.229 | ||
sheet | 0.234 |