Acc_NO	ORF type	length	start-end position (strand +/-)
>MH069738.1	internal	201	1-603(+)
Amino Acid sequence :
YKLTYYTPEYETKDTDILAAFRVTPQPGVPPEEAGAAVAAESSTGTWTTVWTDGLTSLDRYKGRCYHIEPVVGEQNQYIAYVAYPLDLFEEGSVTNMFTSIVGNVFGFKALRALRLEDLR IPPAYSKTFQGPPHGIQVERDKLNKYGRPLLGCTIKPKLGLSAKNYGRAVYECLRGGLDFTKDDENVNSQPFMRWRDRFLF
Physicochemical properties
Number of amino acids:		201
Molecular weight:		22,724.479
Theoretical pI:		6.932
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines-		35870 35995
Instability index:		33.770
aromaticity		0.129
GRAVY		-0.421
Secondary Structure Fraction
Helix		0.318
turn		0.229
sheet		0.234