| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >MH069748.1 | internal | 201 | 1-603(+) |
Amino Acid sequence : | |||
| YKLTYYTPDYVTKDTDILAAFRVTPQPGVPPEEAGAAVAAESSTGTWTTVWTDGLTSLDRYKGRCYNIEPVAGEENQYICYVAYPLDLFEEGSVTNMFTSIVGNVFGFKALRALRLEDLR IPPAYSKTFQGPPHGIQVERDKLNKYGRPLLGCTIKPKLGLSAKNYGRAVYECLRGGLDFTKDDENVNSQPFMRWRDRFLF | |||
Physicochemical properties | |||
| Number of amino acids: | 201 | ||
| Molecular weight: | 22,662.430 | ||
| Theoretical pI: | 6.800 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 35870 36120 | ||
| Instability index: | 32.955 | ||
| aromaticity | 0.129 | ||
| GRAVY | -0.393 | ||
Secondary Structure Fraction | |||
| Helix | 0.318 | ||
| turn | 0.234 | ||
| sheet | 0.229 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >MH069748.1 | internal | 201 | 1-603(+) |
Amino Acid sequence : | |||
| YKLTYYTPDYVTKDTDILAAFRVTPQPGVPPEEAGAAVAAESSTGTWTTVWTDGLTSLDRYKGRCYNIEPVAGEENQYICYVAYPLDLFEEGSVTNMFTSIVGNVFGFKALRALRLEDLR IPPAYSKTFQGPPHGIQVERDKLNKYGRPLLGCTIKPKLGLSAKNYGRAVYECLRGGLDFTKDDENVNSQPFMRWRDRFLF | |||
Physicochemical properties | |||
| Number of amino acids: | 201 | ||
| Molecular weight: | 22,662.430 | ||
| Theoretical pI: | 6.800 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 35870 36120 | ||
| Instability index: | 32.955 | ||
| aromaticity | 0.129 | ||
| GRAVY | -0.393 | ||
Secondary Structure Fraction | |||
| Helix | 0.318 | ||
| turn | 0.234 | ||
| sheet | 0.229 | ||