| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >MH069805.1 | internal | 201 | 1-603(+) |
Amino Acid sequence : | |||
| YKLTYYTPEYETKDTDILAAFRVTPQPGVPPEEAGAAVAAESSTGTWTTVWTDGLTSLDRYKGRCYHIEPVVGEKDQYICYVAYPLDLFEEGSVTNMFTSIVGNVFGFKALRALRLEDLR IPPAYVKTFQGPPHGIQVERDKLNKYGRPLLGCTIKPKLGLSAKNYGRAVYECLRGGLDFTKDDENVNSQPFMRWRDRFLF | |||
Physicochemical properties | |||
| Number of amino acids: | 201 | ||
| Molecular weight: | 22,769.626 | ||
| Theoretical pI: | 6.924 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 35870 36120 | ||
| Instability index: | 33.043 | ||
| aromaticity | 0.129 | ||
| GRAVY | -0.395 | ||
Secondary Structure Fraction | |||
| Helix | 0.323 | ||
| turn | 0.219 | ||
| sheet | 0.229 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >MH069805.1 | internal | 201 | 1-603(+) |
Amino Acid sequence : | |||
| YKLTYYTPEYETKDTDILAAFRVTPQPGVPPEEAGAAVAAESSTGTWTTVWTDGLTSLDRYKGRCYHIEPVVGEKDQYICYVAYPLDLFEEGSVTNMFTSIVGNVFGFKALRALRLEDLR IPPAYVKTFQGPPHGIQVERDKLNKYGRPLLGCTIKPKLGLSAKNYGRAVYECLRGGLDFTKDDENVNSQPFMRWRDRFLF | |||
Physicochemical properties | |||
| Number of amino acids: | 201 | ||
| Molecular weight: | 22,769.626 | ||
| Theoretical pI: | 6.924 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 35870 36120 | ||
| Instability index: | 33.043 | ||
| aromaticity | 0.129 | ||
| GRAVY | -0.395 | ||
Secondary Structure Fraction | |||
| Helix | 0.323 | ||
| turn | 0.219 | ||
| sheet | 0.229 | ||