Acc_NO	ORF type	length	start-end position (strand +/-)
>MH069806.1	internal	201	1-603(+)
Amino Acid sequence :
YKLTYYTPEYETKDTDILAAFRVTPQPGVPPEEAGAAVAAESSTGTWTTVWTDGLTSLDRYKGRCYNIEPVVGEKDQYICYVAYPLDLFEEGSVTNMFTSIVGNVFGFKALRALRLEDLR IPPAYVKTFQGPPHGIQVERDKLNKYGRPLLGCTIKPKLGLSAKNYGRAVYECLRGGLDFTKDDENVNSQPFMRWRDRFLF
Physicochemical properties
Number of amino acids:		201
Molecular weight:		22,746.589
Theoretical pI:		6.805
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines-		35870 36120
Instability index:		32.429
aromaticity		0.129
GRAVY		-0.397
Secondary Structure Fraction
Helix		0.323
turn		0.224
sheet		0.229