Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>MH069806.1 | internal | 201 | 1-603(+) |
Amino Acid sequence : | |||
YKLTYYTPEYETKDTDILAAFRVTPQPGVPPEEAGAAVAAESSTGTWTTVWTDGLTSLDRYKGRCYNIEPVVGEKDQYICYVAYPLDLFEEGSVTNMFTSIVGNVFGFKALRALRLEDLR IPPAYVKTFQGPPHGIQVERDKLNKYGRPLLGCTIKPKLGLSAKNYGRAVYECLRGGLDFTKDDENVNSQPFMRWRDRFLF | |||
Physicochemical properties | |||
Number of amino acids: | 201 | ||
Molecular weight: | 22,746.589 | ||
Theoretical pI: | 6.805 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 35870 36120 | ||
Instability index: | 32.429 | ||
aromaticity | 0.129 | ||
GRAVY | -0.397 | ||
Secondary Structure Fraction | |||
Helix | 0.323 | ||
turn | 0.224 | ||
sheet | 0.229 |