Acc_NO	ORF type	length	start-end position (strand +/-)
>MH069826.1	internal	201	1-603(+)
Amino Acid sequence :
YKLTYYTPDYQTLDTDILAAFRVTAQPGVPPEEAGAAVAAESSTGTWTTVWTDGLTSLDRYKGRCYHIEPVPGEESQFIAYVAYPLDLFEEGSVTNMFTSIVGNVFGFKALRALRLEDLR IPPAYSKTFQGPPHGIQVERDKLNKYGRPLLGCTIKPKLGLSAKNYGRAVYECLRGGLDFTKDDENVNSQPFMRWRDRFLF
Physicochemical properties
Number of amino acids:		201
Molecular weight:		22,624.360
Theoretical pI:		6.196
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines-		34380 34505
Instability index:		36.283
aromaticity		0.129
GRAVY		-0.361
Secondary Structure Fraction
Helix		0.318
turn		0.229
sheet		0.239