Acc_NO	ORF type	length	start-end position (strand +/-)
>MH092639.1	internal	175	3-527(+)
Amino Acid sequence :
TKLTYYTPEYQTKDTDILAAFRVTPQPGVPPEEAGAAVAAKSYTGTWTTVWTDGLTSLDRYKGRCYRIERVVGEKDQYIAYVAYPLDLFEEGSVTNMFTSIVGNVFGFKALRALRLEDLR IPTAYVKTFQGPPHGIQVERDKLNKYGRPLLGCTIKPKLGLSAKNYGRAVYECLR
Physicochemical properties
Number of amino acids:		175
Molecular weight:		19,658.293
Theoretical pI:		9.167
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines-		30370 30495
Instability index:		20.125
aromaticity		0.120
GRAVY		-0.334
Secondary Structure Fraction
Helix		0.326
turn		0.200
sheet		0.234