| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >MH104875.1 | 3prime_partial | 312 | 2-937(+) |
Amino Acid sequence : | |||
| MIPMVDMARLLADRGVLVSIITTPVNAARIKPVIDRSISAGLPIRFVELDFPCAKAGLPDGCENFDLVPSIDLYKPFVEAFEFLREPLELYLREPDVPVASCLITDSCHWWTAAVARAFG IPRFVFYGPSCFFNLCVHNIRLHDAYGSVVDDFEPVVIPGLPLRVEIAKAQAPGGWFCTPGWEDIHGKVVEAAGTADGVVINTFRDLEPEFLGCYEKAVGKSVWPIGPLSLYNKDFASKA SRGNKASVDEGRLSSWLDSMEPGSVVYVSFGSLARNGPSQVVEIGRGLEGSGRPFVWAMKEAERCPEVEEWM | |||
Physicochemical properties | |||
| Number of amino acids: | 312 | ||
| Molecular weight: | 14,840.554 | ||
| Theoretical pI: | 11.633 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 6990 6990 | ||
| Instability index: | 55.937 | ||
| aromaticity | 0.044 | ||
| GRAVY | -0.918 | ||
Secondary Structure Fraction | |||
| Helix | 0.197 | ||
| turn | 0.285 | ||
| sheet | 0.234 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >MH104875.1 | 5prime_partial | 155 | 938-471(-) |
Amino Acid sequence : | |||
| PSTPPPPDTSRPPSSPTRTASPTPPAPSLSRRPARARCARDCRNSRRRRNPAPSSRASSKAGPRRPTPCFLGSPCSQNPCCRATTDLSATRSFRPPFRSIQGIRAPSRGTYLSRLRPRSL RPPPLCRGCPPSPACKTILRAPALSLSRPVAATRE* | |||
Physicochemical properties | |||
| Number of amino acids: | 155 | ||
| Molecular weight: | 14,840.554 | ||
| Theoretical pI: | 11.633 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 6990 6990 | ||
| Instability index: | 55.937 | ||
| aromaticity | 0.044 | ||
| GRAVY | -0.918 | ||
Secondary Structure Fraction | |||
| Helix | 0.197 | ||
| turn | 0.285 | ||
| sheet | 0.234 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >MH104875.1 | 5prime_partial | 149 | 937-488(-) |
Amino Acid sequence : | |||
| HPLLHLRTPLGLLHRPHERPPRPLQPPPYLDDLRGPVARETAETHVDDGTRLHRVEPARKPALVDRRLVSSARLARKILVVERQRTYRPHALSDRLFVASKEFGLQVAERIYHDSVRGPC GLHHFAVDVLPARRAKPSSGRLRFRYLDP* | |||
Physicochemical properties | |||
| Number of amino acids: | 149 | ||
| Molecular weight: | 14,840.554 | ||
| Theoretical pI: | 11.633 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 6990 6990 | ||
| Instability index: | 55.937 | ||
| aromaticity | 0.044 | ||
| GRAVY | -0.918 | ||
Secondary Structure Fraction | |||
| Helix | 0.197 | ||
| turn | 0.285 | ||
| sheet | 0.234 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >MH104875.1 | 5prime_partial | 138 | 1-417(+) |
Amino Acid sequence : | |||
| HDSDGRHGASPSRPRRPRQHHHHPGQRRPNQARHRPVNIRRPTHPVRGTRLPLRESRPPRRMRELRPRPFDRPLQALRRGLRVSPRALGAVPSRTGRPGRQLSNHRQLPLVDRRGRSCVR HTPVRVLRALVLLQPVRS* | |||
Physicochemical properties | |||
| Number of amino acids: | 138 | ||
| Molecular weight: | 14,840.554 | ||
| Theoretical pI: | 11.633 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 6990 6990 | ||
| Instability index: | 55.937 | ||
| aromaticity | 0.044 | ||
| GRAVY | -0.918 | ||
Secondary Structure Fraction | |||
| Helix | 0.197 | ||
| turn | 0.285 | ||
| sheet | 0.234 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >MH104875.1 | 3prime_partial | 137 | 526-936(+) |
Amino Acid sequence : | |||
| MVLHAGLGGHPRQSGGGRRDRGRSRDKYVPRLGARIPWMLRKGGRKERVADRSVVALQQGFCEQGEPRKQGVGRRGPAFELARLDGAGFRRLREFRQSRAQRALAGRRDREGAGGVGEAV RVGDEGGREVSGGGGVD | |||
Physicochemical properties | |||
| Number of amino acids: | 137 | ||
| Molecular weight: | 14,840.554 | ||
| Theoretical pI: | 11.633 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 6990 6990 | ||
| Instability index: | 55.937 | ||
| aromaticity | 0.044 | ||
| GRAVY | -0.918 | ||
Secondary Structure Fraction | |||
| Helix | 0.197 | ||
| turn | 0.285 | ||
| sheet | 0.234 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >MH104875.1 | 3prime_partial | 312 | 2-937(+) |
Amino Acid sequence : | |||
| MIPMVDMARLLADRGVLVSIITTPVNAARIKPVIDRSISAGLPIRFVELDFPCAKAGLPDGCENFDLVPSIDLYKPFVEAFEFLREPLELYLREPDVPVASCLITDSCHWWTAAVARAFG IPRFVFYGPSCFFNLCVHNIRLHDAYGSVVDDFEPVVIPGLPLRVEIAKAQAPGGWFCTPGWEDIHGKVVEAAGTADGVVINTFRDLEPEFLGCYEKAVGKSVWPIGPLSLYNKDFASKA SRGNKASVDEGRLSSWLDSMEPGSVVYVSFGSLARNGPSQVVEIGRGLEGSGRPFVWAMKEAERCPEVEEWM | |||
Physicochemical properties | |||
| Number of amino acids: | 312 | ||
| Molecular weight: | 14,840.554 | ||
| Theoretical pI: | 11.633 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 6990 6990 | ||
| Instability index: | 55.937 | ||
| aromaticity | 0.044 | ||
| GRAVY | -0.918 | ||
Secondary Structure Fraction | |||
| Helix | 0.197 | ||
| turn | 0.285 | ||
| sheet | 0.234 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >MH104875.1 | 5prime_partial | 155 | 938-471(-) |
Amino Acid sequence : | |||
| PSTPPPPDTSRPPSSPTRTASPTPPAPSLSRRPARARCARDCRNSRRRRNPAPSSRASSKAGPRRPTPCFLGSPCSQNPCCRATTDLSATRSFRPPFRSIQGIRAPSRGTYLSRLRPRSL RPPPLCRGCPPSPACKTILRAPALSLSRPVAATRE* | |||
Physicochemical properties | |||
| Number of amino acids: | 155 | ||
| Molecular weight: | 14,840.554 | ||
| Theoretical pI: | 11.633 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 6990 6990 | ||
| Instability index: | 55.937 | ||
| aromaticity | 0.044 | ||
| GRAVY | -0.918 | ||
Secondary Structure Fraction | |||
| Helix | 0.197 | ||
| turn | 0.285 | ||
| sheet | 0.234 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >MH104875.1 | 5prime_partial | 149 | 937-488(-) |
Amino Acid sequence : | |||
| HPLLHLRTPLGLLHRPHERPPRPLQPPPYLDDLRGPVARETAETHVDDGTRLHRVEPARKPALVDRRLVSSARLARKILVVERQRTYRPHALSDRLFVASKEFGLQVAERIYHDSVRGPC GLHHFAVDVLPARRAKPSSGRLRFRYLDP* | |||
Physicochemical properties | |||
| Number of amino acids: | 149 | ||
| Molecular weight: | 14,840.554 | ||
| Theoretical pI: | 11.633 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 6990 6990 | ||
| Instability index: | 55.937 | ||
| aromaticity | 0.044 | ||
| GRAVY | -0.918 | ||
Secondary Structure Fraction | |||
| Helix | 0.197 | ||
| turn | 0.285 | ||
| sheet | 0.234 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >MH104875.1 | 5prime_partial | 138 | 1-417(+) |
Amino Acid sequence : | |||
| HDSDGRHGASPSRPRRPRQHHHHPGQRRPNQARHRPVNIRRPTHPVRGTRLPLRESRPPRRMRELRPRPFDRPLQALRRGLRVSPRALGAVPSRTGRPGRQLSNHRQLPLVDRRGRSCVR HTPVRVLRALVLLQPVRS* | |||
Physicochemical properties | |||
| Number of amino acids: | 138 | ||
| Molecular weight: | 14,840.554 | ||
| Theoretical pI: | 11.633 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 6990 6990 | ||
| Instability index: | 55.937 | ||
| aromaticity | 0.044 | ||
| GRAVY | -0.918 | ||
Secondary Structure Fraction | |||
| Helix | 0.197 | ||
| turn | 0.285 | ||
| sheet | 0.234 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >MH104875.1 | 3prime_partial | 137 | 526-936(+) |
Amino Acid sequence : | |||
| MVLHAGLGGHPRQSGGGRRDRGRSRDKYVPRLGARIPWMLRKGGRKERVADRSVVALQQGFCEQGEPRKQGVGRRGPAFELARLDGAGFRRLREFRQSRAQRALAGRRDREGAGGVGEAV RVGDEGGREVSGGGGVD | |||
Physicochemical properties | |||
| Number of amino acids: | 137 | ||
| Molecular weight: | 14,840.554 | ||
| Theoretical pI: | 11.633 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 6990 6990 | ||
| Instability index: | 55.937 | ||
| aromaticity | 0.044 | ||
| GRAVY | -0.918 | ||
Secondary Structure Fraction | |||
| Helix | 0.197 | ||
| turn | 0.285 | ||
| sheet | 0.234 | ||