| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >MH104876.1 | 3prime_partial | 322 | 1-966(+) |
Amino Acid sequence : | |||
| MPISANTGKAPHFILVASAGMGHLNPMTRLAATLSSRGCDVSFVAAHPTVSLAESNSISQLLSSFPKIKSLNLPLVQPGPTATAADPFFLRFDSIGRSADNLPPLLEHPDSVSAIVIDVS LSFGYVPVAKKLNVPCYMLFTTCASLFSLFAYFPTHQIADTCRPIGDIEIPGALTVPRSSVIPFLRDPNHPFTTLFLRNSRLLPEFDGVLINTFEALEPEVIAAIRKGHVAPNLPPVISV GPLLPLDGQRPTSLSAWLDRQPPRSVVYVSFGNRTAMTREQIGELGRGLEGSGYRFLWVVKTKVVDRDEGSGNGEVEEALGE | |||
Physicochemical properties | |||
| Number of amino acids: | 322 | ||
| Molecular weight: | 11,379.900 | ||
| Theoretical pI: | 9.731 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 22000 22000 | ||
| Instability index: | 55.123 | ||
| aromaticity | 0.038 | ||
| GRAVY | -0.506 | ||
Secondary Structure Fraction | |||
| Helix | 0.190 | ||
| turn | 0.267 | ||
| sheet | 0.343 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >MH104876.1 | 5prime_partial | 231 | 3-698(+) |
Amino Acid sequence : | |||
| ADLSKHRQSSSLYPGGERRHGPSQSHDEACRHAILPRLRRLLRRRPPHRLPCGVQLHIPTPLLLPQNQITQPPASPTGPHRYRRGSLLPPLRLHRPLRRQPPPAPRTPRQRLRHRHRRQL VLRLRAGGQEAQRPMLHALHYVRVPLLPLRILPHPPDSRHVSTHRRHRNPRGVDRPEILRHPVPPRPQPSLHHAVLEEQQAASGVRRGAHQHVRSVGARGDRGDQERARGA* | |||
Physicochemical properties | |||
| Number of amino acids: | 231 | ||
| Molecular weight: | 11,379.900 | ||
| Theoretical pI: | 9.731 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 22000 22000 | ||
| Instability index: | 55.123 | ||
| aromaticity | 0.038 | ||
| GRAVY | -0.506 | ||
Secondary Structure Fraction | |||
| Helix | 0.190 | ||
| turn | 0.267 | ||
| sheet | 0.343 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >MH104876.1 | 5prime_partial | 185 | 965-408(-) |
Amino Acid sequence : | |||
| SPSASSTSPFPDPSSLSTTFVFTTHKNRYPLPSSPLPSSPICSLVIAVRFPKLTYTTDRGGCRSSQADSEVGRWPSSGSSGPTLITGGRLGATCPFLIAAITSGSNASNVLMSTPSNSGS SLLFLKNSVVKGWLGSRRNGMTEDLGTVNAPGISMSPMGRHVSAIWWVGKYAKREKRDAHVVKSM* | |||
Physicochemical properties | |||
| Number of amino acids: | 185 | ||
| Molecular weight: | 11,379.900 | ||
| Theoretical pI: | 9.731 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 22000 22000 | ||
| Instability index: | 55.123 | ||
| aromaticity | 0.038 | ||
| GRAVY | -0.506 | ||
Secondary Structure Fraction | |||
| Helix | 0.190 | ||
| turn | 0.267 | ||
| sheet | 0.343 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >MH104876.1 | complete | 115 | 570-223(-) |
Amino Acid sequence : | |||
| MVGVAEERDDGGSRDGQRPGDFDVADGSTRVGYLVGGEVCEEGEEGRARSEEHVAWDVELLGHRHVAEGQADVDDDGGDAVGVFEERGEVVGGAADGVEAEEEGIRGGSGGARLD* | |||
Physicochemical properties | |||
| Number of amino acids: | 115 | ||
| Molecular weight: | 11,379.900 | ||
| Theoretical pI: | 9.731 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 22000 22000 | ||
| Instability index: | 55.123 | ||
| aromaticity | 0.038 | ||
| GRAVY | -0.506 | ||
Secondary Structure Fraction | |||
| Helix | 0.190 | ||
| turn | 0.267 | ||
| sheet | 0.343 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >MH104876.1 | complete | 105 | 350-33(-) |
Amino Acid sequence : | |||
| MTMAETLSGCSRSGGRLSAERPMESKRRKKGSAAVAVGPGWTSGRLSDLILGKEERSWDMELDSARETVGWAATKETSQPREDSVAASLVMGLRWPMPALATRIK* | |||
Physicochemical properties | |||
| Number of amino acids: | 105 | ||
| Molecular weight: | 11,379.900 | ||
| Theoretical pI: | 9.731 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 22000 22000 | ||
| Instability index: | 55.123 | ||
| aromaticity | 0.038 | ||
| GRAVY | -0.506 | ||
Secondary Structure Fraction | |||
| Helix | 0.190 | ||
| turn | 0.267 | ||
| sheet | 0.343 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >MH104876.1 | 3prime_partial | 322 | 1-966(+) |
Amino Acid sequence : | |||
| MPISANTGKAPHFILVASAGMGHLNPMTRLAATLSSRGCDVSFVAAHPTVSLAESNSISQLLSSFPKIKSLNLPLVQPGPTATAADPFFLRFDSIGRSADNLPPLLEHPDSVSAIVIDVS LSFGYVPVAKKLNVPCYMLFTTCASLFSLFAYFPTHQIADTCRPIGDIEIPGALTVPRSSVIPFLRDPNHPFTTLFLRNSRLLPEFDGVLINTFEALEPEVIAAIRKGHVAPNLPPVISV GPLLPLDGQRPTSLSAWLDRQPPRSVVYVSFGNRTAMTREQIGELGRGLEGSGYRFLWVVKTKVVDRDEGSGNGEVEEALGE | |||
Physicochemical properties | |||
| Number of amino acids: | 322 | ||
| Molecular weight: | 11,379.900 | ||
| Theoretical pI: | 9.731 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 22000 22000 | ||
| Instability index: | 55.123 | ||
| aromaticity | 0.038 | ||
| GRAVY | -0.506 | ||
Secondary Structure Fraction | |||
| Helix | 0.190 | ||
| turn | 0.267 | ||
| sheet | 0.343 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >MH104876.1 | 5prime_partial | 231 | 3-698(+) |
Amino Acid sequence : | |||
| ADLSKHRQSSSLYPGGERRHGPSQSHDEACRHAILPRLRRLLRRRPPHRLPCGVQLHIPTPLLLPQNQITQPPASPTGPHRYRRGSLLPPLRLHRPLRRQPPPAPRTPRQRLRHRHRRQL VLRLRAGGQEAQRPMLHALHYVRVPLLPLRILPHPPDSRHVSTHRRHRNPRGVDRPEILRHPVPPRPQPSLHHAVLEEQQAASGVRRGAHQHVRSVGARGDRGDQERARGA* | |||
Physicochemical properties | |||
| Number of amino acids: | 231 | ||
| Molecular weight: | 11,379.900 | ||
| Theoretical pI: | 9.731 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 22000 22000 | ||
| Instability index: | 55.123 | ||
| aromaticity | 0.038 | ||
| GRAVY | -0.506 | ||
Secondary Structure Fraction | |||
| Helix | 0.190 | ||
| turn | 0.267 | ||
| sheet | 0.343 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >MH104876.1 | 5prime_partial | 185 | 965-408(-) |
Amino Acid sequence : | |||
| SPSASSTSPFPDPSSLSTTFVFTTHKNRYPLPSSPLPSSPICSLVIAVRFPKLTYTTDRGGCRSSQADSEVGRWPSSGSSGPTLITGGRLGATCPFLIAAITSGSNASNVLMSTPSNSGS SLLFLKNSVVKGWLGSRRNGMTEDLGTVNAPGISMSPMGRHVSAIWWVGKYAKREKRDAHVVKSM* | |||
Physicochemical properties | |||
| Number of amino acids: | 185 | ||
| Molecular weight: | 11,379.900 | ||
| Theoretical pI: | 9.731 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 22000 22000 | ||
| Instability index: | 55.123 | ||
| aromaticity | 0.038 | ||
| GRAVY | -0.506 | ||
Secondary Structure Fraction | |||
| Helix | 0.190 | ||
| turn | 0.267 | ||
| sheet | 0.343 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >MH104876.1 | complete | 115 | 570-223(-) |
Amino Acid sequence : | |||
| MVGVAEERDDGGSRDGQRPGDFDVADGSTRVGYLVGGEVCEEGEEGRARSEEHVAWDVELLGHRHVAEGQADVDDDGGDAVGVFEERGEVVGGAADGVEAEEEGIRGGSGGARLD* | |||
Physicochemical properties | |||
| Number of amino acids: | 115 | ||
| Molecular weight: | 11,379.900 | ||
| Theoretical pI: | 9.731 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 22000 22000 | ||
| Instability index: | 55.123 | ||
| aromaticity | 0.038 | ||
| GRAVY | -0.506 | ||
Secondary Structure Fraction | |||
| Helix | 0.190 | ||
| turn | 0.267 | ||
| sheet | 0.343 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >MH104876.1 | complete | 105 | 350-33(-) |
Amino Acid sequence : | |||
| MTMAETLSGCSRSGGRLSAERPMESKRRKKGSAAVAVGPGWTSGRLSDLILGKEERSWDMELDSARETVGWAATKETSQPREDSVAASLVMGLRWPMPALATRIK* | |||
Physicochemical properties | |||
| Number of amino acids: | 105 | ||
| Molecular weight: | 11,379.900 | ||
| Theoretical pI: | 9.731 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 22000 22000 | ||
| Instability index: | 55.123 | ||
| aromaticity | 0.038 | ||
| GRAVY | -0.506 | ||
Secondary Structure Fraction | |||
| Helix | 0.190 | ||
| turn | 0.267 | ||
| sheet | 0.343 | ||