Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>MH311570.1 | internal | 200 | 2-601(+) |
Amino Acid sequence : | |||
ESKLTYYTPEYQTKDTDILAAFRVTPQPGVPPEEAGAAVAAESSTGTWTTVWTDGLTSLDRYKGRCYRIERVVGEKDQYIAYVAYPLDLFEEGSVTNMFTSIVGNVFGFKALRALRLEDL RIPTAYVKTFQGPPHGIQVERDKLNKYGRPLLGCTIKPKLGLSAKNYGRAVYECLRGGLDFTKDDENVNSQPFMRWRERF | |||
Physicochemical properties | |||
Number of amino acids: | 200 | ||
Molecular weight: | 22,625.395 | ||
Theoretical pI: | 8.392 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 34380 34505 | ||
Instability index: | 27.364 | ||
aromaticity | 0.120 | ||
GRAVY | -0.465 | ||
Secondary Structure Fraction | |||
Helix | 0.310 | ||
turn | 0.215 | ||
sheet | 0.235 |