Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>MH311571.1 | internal | 200 | 2-601(+) |
Amino Acid sequence : | |||
KEYKLIYYTPEYQTKDTDILAAFRVTPQPGVPPEEAGAAVAAESSTGTWTTVWTDGLTSLDRYKGRCYRIERVVGEKDQYIAYVAYPLDLFEEGSVTNMFTSIVGNVFGFKALRALRLED LRIPPAYIKTFQGPPHGIQVERDKLNKYGRPLLGCTIKPKLGLSAKNYGRAVYECLRGGLDFTKDDDNVNSQPFMPWRDR | |||
Physicochemical properties | |||
Number of amino acids: | 200 | ||
Molecular weight: | 22,617.457 | ||
Theoretical pI: | 8.353 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 35870 35995 | ||
Instability index: | 27.236 | ||
aromaticity | 0.120 | ||
GRAVY | -0.464 | ||
Secondary Structure Fraction | |||
Helix | 0.315 | ||
turn | 0.220 | ||
sheet | 0.225 |