Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>MH401132.1 | internal | 210 | 632-3(-) |
Amino Acid sequence : | |||
NWNRLITQKKKSISIFSKKENQRLFLFLYNSHVYECESIFVFLRKQSFYLRLTSYRAFLERTHFYGKMEHLVVVFQNDFQFFLWLFREPFMHYVRYRGKSILGSKGTLLLMNKWNYYLVN LWQCNFDLWSQLDRIYITQLANHYFYFLDYLSSVRLNPSVVRSQMLDNSFIMDIAIKKFDSIVPIISLIGSLAKAKFCNVSGHPISKPAW | |||
Physicochemical properties | |||
Number of amino acids: | 210 | ||
Molecular weight: | 25,332.302 | ||
Theoretical pI: | 9.770 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 52370 52495 | ||
Instability index: | 39.305 | ||
aromaticity | 0.186 | ||
GRAVY | -0.028 | ||
Secondary Structure Fraction | |||
Helix | 0.438 | ||
turn | 0.210 | ||
sheet | 0.205 |