| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >MH468782.1 | internal | 190 | 571-2(-) |
Amino Acid sequence : | |||
| EILDKGSLFLDVLEKRTQLCTGKTKKKYLPKIYDPFLYGPYRGRIKNRRRIKKLFSTVILNETYIKNKIRTSWINKIHSLLLTNDYQEFEQTIDRFNQKSFSREKVRSLFPKHKRKQIDS ENRIPILKFLFEAVITDPNNQRIRKKSIGIKKISKKVSRWSYKLIDNLEQENMIYSGRVPEEYEIRARKC | |||
Physicochemical properties | |||
| Number of amino acids: | 190 | ||
| Molecular weight: | 22,919.512 | ||
| Theoretical pI: | 10.141 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 24410 24535 | ||
| Instability index: | 40.440 | ||
| aromaticity | 0.105 | ||
| GRAVY | -0.805 | ||
Secondary Structure Fraction | |||
| Helix | 0.337 | ||
| turn | 0.195 | ||
| sheet | 0.174 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >MH468782.1 | internal | 190 | 571-2(-) |
Amino Acid sequence : | |||
| EILDKGSLFLDVLEKRTQLCTGKTKKKYLPKIYDPFLYGPYRGRIKNRRRIKKLFSTVILNETYIKNKIRTSWINKIHSLLLTNDYQEFEQTIDRFNQKSFSREKVRSLFPKHKRKQIDS ENRIPILKFLFEAVITDPNNQRIRKKSIGIKKISKKVSRWSYKLIDNLEQENMIYSGRVPEEYEIRARKC | |||
Physicochemical properties | |||
| Number of amino acids: | 190 | ||
| Molecular weight: | 22,919.512 | ||
| Theoretical pI: | 10.141 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 24410 24535 | ||
| Instability index: | 40.440 | ||
| aromaticity | 0.105 | ||
| GRAVY | -0.805 | ||
Secondary Structure Fraction | |||
| Helix | 0.337 | ||
| turn | 0.195 | ||
| sheet | 0.174 | ||