Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>MH538119.1 | internal | 326 | 2-979(+) |
Amino Acid sequence : | |||
DAILVDAKGKFLDRKSMGEDVFWAIRGGGAGSWGAVYGWKIRLVDVPETVTALRVIRVGPRTEASKLLNKWQWVAPNLEDEFSLMASLIPQTENIILSIFQGLYLGPKSSALASISQAFP ELEVVESECKEMKWVETTAFFPDFTGQFTVDDLKNRFATSEQKSYLKWKGDYVRNQISGEGIEGMIDFLIKQPRGQIQLVPYGGIMARIPSDVIPHPHREGILYTIGYLVAWNEDENDRS DTFMDWIHGLHEYMTPFVSKEPRVAYVNEVDLDLGVMDWENHEISADELVELGRRWGEKYFLANYDRLVRAKSVIDPNNVFKHQQS | |||
Physicochemical properties | |||
Number of amino acids: | 326 | ||
Molecular weight: | 14,958.594 | ||
Theoretical pI: | 10.090 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 20970 21095 | ||
Instability index: | 66.405 | ||
aromaticity | 0.094 | ||
GRAVY | 0.052 | ||
Secondary Structure Fraction | |||
Helix | 0.386 | ||
turn | 0.228 | ||
sheet | 0.165 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>MH538119.1 | 5prime_partial | 127 | 979-596(-) |
Amino Acid sequence : | |||
ALLVFKHIVWINHTLGPNQPVIVCQKVLLPPSSPQLYKLISRDFMVFPVHYSEIKIHFIHISHSRFLRHKRRHVLMKSMYPIHESIASIVLILIPSHKVPNSVKDTFSMRMWNNIAWDPC HDTSIRH* | |||
Physicochemical properties | |||
Number of amino acids: | 127 | ||
Molecular weight: | 14,958.594 | ||
Theoretical pI: | 10.090 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 20970 21095 | ||
Instability index: | 66.405 | ||
aromaticity | 0.094 | ||
GRAVY | 0.052 | ||
Secondary Structure Fraction | |||
Helix | 0.386 | ||
turn | 0.228 | ||
sheet | 0.165 |