Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>MH551264.1 | internal | 147 | 3-443(+) |
Amino Acid sequence : | |||
TKDTDILAAFRVTPQPGVPPEEAGAAVAAESSTGTWTTVWTDGLTSLDRYKGRCYRIERVVGEKDQYIAYVAYPLDLFEEGSVTNMFTSIVGNVFGFKALRALRLEDLRIPTAYVKTFQG PPHGIQVERDKLNKYGRPLLGCTIKPK | |||
Physicochemical properties | |||
Number of amino acids: | 147 | ||
Molecular weight: | 16,299.430 | ||
Theoretical pI: | 8.525 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 21430 21555 | ||
Instability index: | 20.956 | ||
aromaticity | 0.102 | ||
GRAVY | -0.275 | ||
Secondary Structure Fraction | |||
Helix | 0.313 | ||
turn | 0.211 | ||
sheet | 0.231 |