Acc_NO	ORF type	length	start-end position (strand +/-)
>MH569065.1	internal	159	1-477(+)
Amino Acid sequence :
LLVQTLRCWIQDAASLHLLRFFFYEYHNWNRLITQKKKSISIFSKKENQRLFLFLYNSHVYECESIFVFLRKQSFYLRLTSYRAFLERTHFYGKMEHLVVVFQNYFQFFLWLFREPFMHY VRYRGKSILGSKGTLLLMNKWNYYLVNLWQCNFDLWSQL
Physicochemical properties
Number of amino acids:		159
Molecular weight:		19,885.016
Theoretical pI:		9.787
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines-		50880 51005
Instability index:		45.376
aromaticity		0.226
GRAVY		-0.089
Secondary Structure Fraction
Helix		0.472
turn		0.157
sheet		0.239