Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>MH569065.1 | internal | 159 | 1-477(+) |
Amino Acid sequence : | |||
LLVQTLRCWIQDAASLHLLRFFFYEYHNWNRLITQKKKSISIFSKKENQRLFLFLYNSHVYECESIFVFLRKQSFYLRLTSYRAFLERTHFYGKMEHLVVVFQNYFQFFLWLFREPFMHY VRYRGKSILGSKGTLLLMNKWNYYLVNLWQCNFDLWSQL | |||
Physicochemical properties | |||
Number of amino acids: | 159 | ||
Molecular weight: | 19,885.016 | ||
Theoretical pI: | 9.787 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 50880 51005 | ||
Instability index: | 45.376 | ||
aromaticity | 0.226 | ||
GRAVY | -0.089 | ||
Secondary Structure Fraction | |||
Helix | 0.472 | ||
turn | 0.157 | ||
sheet | 0.239 |