Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>MH569072.1 | internal | 125 | 1-375(+) |
Amino Acid sequence : | |||
DIEPVAGEENQYICYVAYPLDLFEEGSVTNMFTSIVGNVFGFKALRALRLEDLRIPIAYIKTFQGPPHGIQVERDKLNKYGRPLLGCTIKPKLGLSAKNYGRAVYECLRGGLDFTKDDEN VNSQP | |||
Physicochemical properties | |||
Number of amino acids: | 125 | ||
Molecular weight: | 14,000.854 | ||
Theoretical pI: | 5.855 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 10430 10555 | ||
Instability index: | 31.000 | ||
aromaticity | 0.104 | ||
GRAVY | -0.288 | ||
Secondary Structure Fraction | |||
Helix | 0.336 | ||
turn | 0.248 | ||
sheet | 0.240 |