Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>MH588529.1 | internal | 214 | 1-642(+) |
Amino Acid sequence : | |||
EYKLTYYTPEYQTKDTDILAAFRVTPQPGVPPEEAGAAVAAESSTGTWTTVWTDGLTSLDRYKGRCYRIERVVGEKDQYIAYVAYPLDLFEEGSVTNMFTSIVGNVFGFKALRALRLEDL RIPTAYVKTFQGPPHGIQVERDKLNKYGRPLLGCTIKPKLGLSAKNYGRAVYECLRGGLDFTKDDENVNSQPFMRWRDRFLFCAEALFKAQTET | |||
Physicochemical properties | |||
Number of amino acids: | 214 | ||
Molecular weight: | 24,241.241 | ||
Theoretical pI: | 7.842 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 35870 36120 | ||
Instability index: | 25.173 | ||
aromaticity | 0.126 | ||
GRAVY | -0.412 | ||
Secondary Structure Fraction | |||
Helix | 0.313 | ||
turn | 0.196 | ||
sheet | 0.248 |