Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>MH660015.1 | internal | 263 | 1-789(+) |
Amino Acid sequence : | |||
ASSLHLLRLFLHEYSNWNSIITPKNSVFIFSKSNPRLFLFLYNSHVCEYESILLFLRNQPSHLRLMSSGSFFERIFFYAKIKHPVEEAFANDFSATPWFFKAPFMHYVRYRGKSILTSKD TPLLMNKWKYYLIYLWQCSFYVWSQPTRIYINPLSKHSLAFLGYFSSIRLNLSVVRSQMLKNSFIMDNAMKRLDTLVPISPLIGSLAKMKFCNGLGHPVSKSIWADSSDLDIIDRFAHIC RNLSHYYSGSSKKKGLYRIKYIL | |||
Physicochemical properties | |||
Number of amino acids: | 263 | ||
Molecular weight: | 30,913.753 | ||
Theoretical pI: | 9.845 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 56840 57090 | ||
Instability index: | 39.932 | ||
aromaticity | 0.163 | ||
GRAVY | -0.026 | ||
Secondary Structure Fraction | |||
Helix | 0.399 | ||
turn | 0.262 | ||
sheet | 0.217 |