Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>MH748574.1 | complete | 121 | 696-1061(+) |
Amino Acid sequence : | |||
MTCRGWGCPIISKMSSKKSCPLYISTITITRTLFQKKKGISTPHLLHLGSSENMVFKSHKVSQYQYNSILSIPQIYSPLLNWEPAYMQRYSTVSRTKRVSSKRALATTPEDCCNCMKLPF C* | |||
Physicochemical properties | |||
Number of amino acids: | 121 | ||
Molecular weight: | 11,918.927 | ||
Theoretical pI: | 9.689 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 8480 8605 | ||
Instability index: | 54.596 | ||
aromaticity | 0.131 | ||
GRAVY | -0.091 | ||
Secondary Structure Fraction | |||
Helix | 0.404 | ||
turn | 0.172 | ||
sheet | 0.222 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>MH748574.1 | complete | 108 | 1-327(+) |
Amino Acid sequence : | |||
MALKVFSVATQTAIPSKLTTCLQPSHLKSSPKLFSSTNKCSGRSRLRVYCSSSQLTTERRSGNYNPSRWDVEFIQSLHSDYKVCKTRSFRQGRSQENVYGRGEISYMG* | |||
Physicochemical properties | |||
Number of amino acids: | 108 | ||
Molecular weight: | 11,918.927 | ||
Theoretical pI: | 9.689 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 8480 8605 | ||
Instability index: | 54.596 | ||
aromaticity | 0.131 | ||
GRAVY | -0.091 | ||
Secondary Structure Fraction | |||
Helix | 0.404 | ||
turn | 0.172 | ||
sheet | 0.222 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>MH748574.1 | complete | 101 | 2729-3034(+) |
Amino Acid sequence : | |||
MYVQEEVSRGDVPKSLQCYMSDYNASEAEARKHVKWLIAEVWKKMNAERVSKDSPFGKDFIGCAVDLGRMAQLMYHNGDGHGTQHPIIHQQMTRTLFEPFA* | |||
Physicochemical properties | |||
Number of amino acids: | 101 | ||
Molecular weight: | 11,918.927 | ||
Theoretical pI: | 9.689 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 8480 8605 | ||
Instability index: | 54.596 | ||
aromaticity | 0.131 | ||
GRAVY | -0.091 | ||
Secondary Structure Fraction | |||
Helix | 0.404 | ||
turn | 0.172 | ||
sheet | 0.222 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>MH748574.1 | complete | 101 | 1182-877(-) |
Amino Acid sequence : | |||
MSKEYAILVKRSPSPPPSFTLSSKNLVANSLADSSVVSPSVNRKEASYSCNNPLVSSLRLSLNSPSSFLKLSNTSAYMPVPNLVKENKFVEWKVWNYIDIG* | |||
Physicochemical properties | |||
Number of amino acids: | 101 | ||
Molecular weight: | 11,918.927 | ||
Theoretical pI: | 9.689 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 8480 8605 | ||
Instability index: | 54.596 | ||
aromaticity | 0.131 | ||
GRAVY | -0.091 | ||
Secondary Structure Fraction | |||
Helix | 0.404 | ||
turn | 0.172 | ||
sheet | 0.222 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>MH748574.1 | complete | 99 | 856-557(-) |
Amino Acid sequence : | |||
MFSEEPKCKRCGVEIPFFFWKRVLVIVMVEIYRGQDFFELILEMIGQPHPLQVIDQLKLSNLIRFFLQFHLHQSDQLRSPNRVFVLLHTARGGRRKNYQ* | |||
Physicochemical properties | |||
Number of amino acids: | 99 | ||
Molecular weight: | 11,918.927 | ||
Theoretical pI: | 9.689 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 8480 8605 | ||
Instability index: | 54.596 | ||
aromaticity | 0.131 | ||
GRAVY | -0.091 | ||
Secondary Structure Fraction | |||
Helix | 0.404 | ||
turn | 0.172 | ||
sheet | 0.222 |