Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>MH765688.1 | internal | 197 | 1-591(+) |
Amino Acid sequence : | |||
KAGVKDYKLTYYTPDYVPKDTDTLAAFRVTPQPGVPPEEAGAAVAAESSTGTWTTVWTDGLTSLDRYKGRCYDIEPVAGEENQYICYVAYPLDLFEEGSVTNMFTSIVGNVFGFKALRAL RLEDLRIPIAYIKTFQGPPHGIQVERDKLNKYGRPLLGCTIKPKLGLSAKNYGRAVYECLRGGLDFTKDDENVNSQP | |||
Physicochemical properties | |||
Number of amino acids: | 197 | ||
Molecular weight: | 21,832.458 | ||
Theoretical pI: | 5.552 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 30370 30620 | ||
Instability index: | 26.408 | ||
aromaticity | 0.112 | ||
GRAVY | -0.384 | ||
Secondary Structure Fraction | |||
Helix | 0.310 | ||
turn | 0.234 | ||
sheet | 0.228 |