Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>MH931116.1 | internal | 146 | 1-438(+) |
Amino Acid sequence : | |||
ALXXXVFCDADVALIVFSTKGKLFEYSTDSSMESILERYERYSCAERKMNANDSDPKENWSVEYPKLMSRIELLQRNIRHYMGQDLDPLGLRELQSLEQQIDTSLKRIRSRKNQLMHESI SELQRKEKALQEQNNLITKKLKENEK | |||
Physicochemical properties | |||
Number of amino acids: | 146 | ||
Molecular weight: | 16,886.033 | ||
Theoretical pI: | 6.986 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 12950 13075 | ||
Instability index: | 66.797 | ||
aromaticity | 0.063 | ||
GRAVY | -0.857 | ||
Secondary Structure Fraction | |||
Helix | 0.273 | ||
turn | 0.196 | ||
sheet | 0.315 |