Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>MH931117.1 | internal | 146 | 1-438(+) |
Amino Acid sequence : | |||
ELSVLCDAEVGLIVFSTKGKLFEYATDSCMERILERYERYSFAERQVAPTDHTSPRSWILEQAKLKARLEVLQGNQKHYVGEDLESLNMKELQNLEHQLDSALKHIRSRKNQLMHESISV LQKKDKALQDQNNQLSKKVKEREKEL | |||
Physicochemical properties | |||
Number of amino acids: | 146 | ||
Molecular weight: | 17,069.242 | ||
Theoretical pI: | 7.214 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 11460 11585 | ||
Instability index: | 48.215 | ||
aromaticity | 0.055 | ||
GRAVY | -0.796 | ||
Secondary Structure Fraction | |||
Helix | 0.281 | ||
turn | 0.164 | ||
sheet | 0.329 |