Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>MK017801.1 | 3prime_partial | 119 | 2-358(+) |
Amino Acid sequence : | |||
MCIRDSLNPFQPSASSSSSSSNTLSRRAFTVRAARGKFERKKPHVNIGTIGHVDHGKTTLTAALTMALASLGGSAPKKYDEIDAAPEERARGITINTATVEYETENRHYAHVDCPGHAD | |||
Physicochemical properties | |||
Number of amino acids: | 119 | ||
Molecular weight: | 12,824.126 | ||
Theoretical pI: | 8.665 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 4470 4595 | ||
Instability index: | 47.841 | ||
aromaticity | 0.050 | ||
GRAVY | -0.576 | ||
Secondary Structure Fraction | |||
Helix | 0.193 | ||
turn | 0.261 | ||
sheet | 0.252 |