Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>MK050816.1 | complete | 102 | 1-309(+) |
Amino Acid sequence : | |||
MSGGVGSGLKKGPWTAAEDAILVDYVKKHGEGNWNAVQKHSGLFRCGKSCRLRWANHLRPNLKKGAFTAEEERIIIELHARLGNKWARMAASVSLSYSLCTY* | |||
Physicochemical properties | |||
Number of amino acids: | 102 | ||
Molecular weight: | 11,300.895 | ||
Theoretical pI: | 9.763 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 26470 26595 | ||
Instability index: | 35.587 | ||
aromaticity | 0.088 | ||
GRAVY | -0.375 | ||
Secondary Structure Fraction | |||
Helix | 0.275 | ||
turn | 0.255 | ||
sheet | 0.284 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>MK050816.1 | complete | 102 | 1-309(+) |
Amino Acid sequence : | |||
MSGGVGSGLKKGPWTAAEDAILVDYVKKHGEGNWNAVQKHSGLFRCGKSCRLRWANHLRPNLKKGAFTAEEERIIIELHARLGNKWARMAASVSLSYSLCTY* | |||
Physicochemical properties | |||
Number of amino acids: | 102 | ||
Molecular weight: | 11,300.895 | ||
Theoretical pI: | 9.763 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 26470 26595 | ||
Instability index: | 35.587 | ||
aromaticity | 0.088 | ||
GRAVY | -0.375 | ||
Secondary Structure Fraction | |||
Helix | 0.275 | ||
turn | 0.255 | ||
sheet | 0.284 |