| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >MK050817.1 | complete | 201 | 1-606(+) |
Amino Acid sequence : | |||
| MGRSPCCEKAHTNKGAWTKEEDERLISHIRAHGEGCWRSLPKAAGLHRCGKSCRLRWINYLRPDLKRGNFTEEEDELIIKLHSLLGNKWSLIAGRLPGRTDNEIKNYWNTHIRRKLLSRG VDPATHRSISATNNIVFDHKNHIRDQEEDYKSSSGGSSSDESSCWEQKLQVFRVPDLNLELRISPPFQFADSAVLDYVHKC* | |||
Physicochemical properties | |||
| Number of amino acids: | 201 | ||
| Molecular weight: | 23,133.820 | ||
| Theoretical pI: | 8.838 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 38960 39335 | ||
| Instability index: | 66.166 | ||
| aromaticity | 0.075 | ||
| GRAVY | -0.799 | ||
Secondary Structure Fraction | |||
| Helix | 0.259 | ||
| turn | 0.254 | ||
| sheet | 0.224 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >MK050817.1 | complete | 201 | 1-606(+) |
Amino Acid sequence : | |||
| MGRSPCCEKAHTNKGAWTKEEDERLISHIRAHGEGCWRSLPKAAGLHRCGKSCRLRWINYLRPDLKRGNFTEEEDELIIKLHSLLGNKWSLIAGRLPGRTDNEIKNYWNTHIRRKLLSRG VDPATHRSISATNNIVFDHKNHIRDQEEDYKSSSGGSSSDESSCWEQKLQVFRVPDLNLELRISPPFQFADSAVLDYVHKC* | |||
Physicochemical properties | |||
| Number of amino acids: | 201 | ||
| Molecular weight: | 23,133.820 | ||
| Theoretical pI: | 8.838 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 38960 39335 | ||
| Instability index: | 66.166 | ||
| aromaticity | 0.075 | ||
| GRAVY | -0.799 | ||
Secondary Structure Fraction | |||
| Helix | 0.259 | ||
| turn | 0.254 | ||
| sheet | 0.224 | ||