Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>MK050822.1 | complete | 318 | 1-957(+) |
Amino Acid sequence : | |||
MASRTKEMDRIKGPWSPEEDDALQKLVQRHGPRNWSLISKSIPGRSGKSCRLRWCNQLSPQVEHRPFSAEEDEMIIRAHSRFGNKWATIARMLSGRTDNAIKNHWNSTLKRKYTPSGGSD DGSLFAPLDLDDPRPIKRSNSAGPVISLTPGSPSGSDVSDSSHQSYPLMAAPPSPPPQIYRPVARTGPILPVEELVKSDPFSLSLSLSLPGSSADERAAEHEMMLFPPPACKSPPPAMLP AAEPMSVDRSSPEKTEERKSGFAFSSDFLTVMQEMIRTEVRNYMSGMEQTGGMMCAAPASAETIRNAAMKRMGITKIE* | |||
Physicochemical properties | |||
Number of amino acids: | 318 | ||
Molecular weight: | 13,300.338 | ||
Theoretical pI: | 12.000 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 2980 2980 | ||
Instability index: | 124.732 | ||
aromaticity | 0.056 | ||
GRAVY | -1.277 | ||
Secondary Structure Fraction | |||
Helix | 0.262 | ||
turn | 0.206 | ||
sheet | 0.196 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>MK050822.1 | 5prime_partial | 107 | 957-634(-) |
Amino Acid sequence : | |||
LLDLGDPHPFHGGVPNGLRRRRSSTHHPSGLLHPRHVVPHLRPYHFLHHRQEVRTESKSRFPLLRLLRRTPIYRHRLRRRQHRRRRRFARRRGEQHHLMLRRPLVRR* | |||
Physicochemical properties | |||
Number of amino acids: | 107 | ||
Molecular weight: | 13,300.338 | ||
Theoretical pI: | 12.000 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 2980 2980 | ||
Instability index: | 124.732 | ||
aromaticity | 0.056 | ||
GRAVY | -1.277 | ||
Secondary Structure Fraction | |||
Helix | 0.262 | ||
turn | 0.206 | ||
sheet | 0.196 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>MK050822.1 | complete | 318 | 1-957(+) |
Amino Acid sequence : | |||
MASRTKEMDRIKGPWSPEEDDALQKLVQRHGPRNWSLISKSIPGRSGKSCRLRWCNQLSPQVEHRPFSAEEDEMIIRAHSRFGNKWATIARMLSGRTDNAIKNHWNSTLKRKYTPSGGSD DGSLFAPLDLDDPRPIKRSNSAGPVISLTPGSPSGSDVSDSSHQSYPLMAAPPSPPPQIYRPVARTGPILPVEELVKSDPFSLSLSLSLPGSSADERAAEHEMMLFPPPACKSPPPAMLP AAEPMSVDRSSPEKTEERKSGFAFSSDFLTVMQEMIRTEVRNYMSGMEQTGGMMCAAPASAETIRNAAMKRMGITKIE* | |||
Physicochemical properties | |||
Number of amino acids: | 318 | ||
Molecular weight: | 13,300.338 | ||
Theoretical pI: | 12.000 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 2980 2980 | ||
Instability index: | 124.732 | ||
aromaticity | 0.056 | ||
GRAVY | -1.277 | ||
Secondary Structure Fraction | |||
Helix | 0.262 | ||
turn | 0.206 | ||
sheet | 0.196 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>MK050822.1 | 5prime_partial | 107 | 957-634(-) |
Amino Acid sequence : | |||
LLDLGDPHPFHGGVPNGLRRRRSSTHHPSGLLHPRHVVPHLRPYHFLHHRQEVRTESKSRFPLLRLLRRTPIYRHRLRRRQHRRRRRFARRRGEQHHLMLRRPLVRR* | |||
Physicochemical properties | |||
Number of amino acids: | 107 | ||
Molecular weight: | 13,300.338 | ||
Theoretical pI: | 12.000 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 2980 2980 | ||
Instability index: | 124.732 | ||
aromaticity | 0.056 | ||
GRAVY | -1.277 | ||
Secondary Structure Fraction | |||
Helix | 0.262 | ||
turn | 0.206 | ||
sheet | 0.196 |