Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>MK087867.1 | 5prime_partial | 122 | 1-369(+) |
Amino Acid sequence : | |||
CRIPRTIEFLNASCARGHPAEGTPAWASRLASLRLPRPEHPVLLWRRAADAEIGPPCLAVRWVEVSSPAGLGTVSGGRTSSRAPDAVKNHPDAGYMTEMIRTHTEGRSAPSDRDPRSGGN TR* | |||
Physicochemical properties | |||
Number of amino acids: | 122 | ||
Molecular weight: | 13,131.645 | ||
Theoretical pI: | 10.057 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 17990 18115 | ||
Instability index: | 61.594 | ||
aromaticity | 0.041 | ||
GRAVY | -0.575 | ||
Secondary Structure Fraction | |||
Helix | 0.189 | ||
turn | 0.311 | ||
sheet | 0.262 |