Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>MK087935.1 | 5prime_partial | 133 | 3-404(+) |
Amino Acid sequence : | |||
QNPVNHRVFERKLRPKPLGRGPACLGVTHRVAPHPRAHRRAAGGGNWPPVRLGVRPAQMGSPGDWASRQVVVEHLNLSRGXAAVSSRTGIENDPTVLXANSVSPSTATPGQAGLPAEFKH INKRRKRNLQGFP* | |||
Physicochemical properties | |||
Number of amino acids: | 133 | ||
Molecular weight: | 14,144.964 | ||
Theoretical pI: | 12.000 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 11000 11000 | ||
Instability index: | 63.812 | ||
aromaticity | 0.038 | ||
GRAVY | -0.677 | ||
Secondary Structure Fraction | |||
Helix | 0.214 | ||
turn | 0.344 | ||
sheet | 0.206 |