Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>MK090271.1 | 5prime_partial | 183 | 2-553(+) |
Amino Acid sequence : | |||
KASVGFKAGVKDYKLTYYTPDYQTKDTDILAAFRVTPQPGVPPEEAGAAVAAESSTGTWTTVWTDGLTSLDRYKGRCYHLEPVAGEENQYIAYVAYPLDLFEEGSVTNMFTSIVGNVFGF KALRALRLEDLRIPTAYAKTFQGPPHGIQVERDKLNKYGRPLLGCTIKPKLGLSAKNYGRACL* | |||
Physicochemical properties | |||
Number of amino acids: | 183 | ||
Molecular weight: | 20,137.687 | ||
Theoretical pI: | 8.668 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 28880 29005 | ||
Instability index: | 23.805 | ||
aromaticity | 0.115 | ||
GRAVY | -0.305 | ||
Secondary Structure Fraction | |||
Helix | 0.306 | ||
turn | 0.224 | ||
sheet | 0.251 |