| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >MK090291.1 | internal | 187 | 561-1(-) |
Amino Acid sequence : | |||
| TKASVGFKAGVKEYKLTYYTPEYETKDTDILAAFRVTPQPGVPPEEAGAAVAAESSTGTWTTVWTDGLTSLDRYKGRCYHIEPVPGEKDQYICYVAYPLDLFEEGSVTNMFTSIVGNVFG FKALRALRLEDLRIPVAYVKTFQGPPHGIQVERDKLNKYGRPLLGCTIKPKLGLSAKNYGRAVYECL | |||
Physicochemical properties | |||
| Number of amino acids: | 187 | ||
| Molecular weight: | 20,743.473 | ||
| Theoretical pI: | 8.238 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 30370 30620 | ||
| Instability index: | 27.632 | ||
| aromaticity | 0.118 | ||
| GRAVY | -0.280 | ||
Secondary Structure Fraction | |||
| Helix | 0.321 | ||
| turn | 0.219 | ||
| sheet | 0.241 | ||