| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >MK090293.1 | internal | 186 | 2-559(+) |
Amino Acid sequence : | |||
| KASVGFKAGVKEYKLTYYTPEYETKDTDILAAFRVTPQPGVPPEEAGAAVAAESSTGTWTTVWTDGLTSLDRYKGRCYDIEPVVGEKDQYICYVAYPLDLFEEGSVTNMFTSIVGNVFGF KALRALRLEDLRIPPAYVKTFQGPPHGIQVERDKLNKYGRPLLGCTIKPKLGLSAKNYGRAVYECL | |||
Physicochemical properties | |||
| Number of amino acids: | 186 | ||
| Molecular weight: | 20,620.317 | ||
| Theoretical pI: | 7.765 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 30370 30620 | ||
| Instability index: | 25.517 | ||
| aromaticity | 0.118 | ||
| GRAVY | -0.279 | ||
Secondary Structure Fraction | |||
| Helix | 0.323 | ||
| turn | 0.220 | ||
| sheet | 0.242 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >MK090293.1 | internal | 186 | 2-559(+) |
Amino Acid sequence : | |||
| KASVGFKAGVKEYKLTYYTPEYETKDTDILAAFRVTPQPGVPPEEAGAAVAAESSTGTWTTVWTDGLTSLDRYKGRCYDIEPVVGEKDQYICYVAYPLDLFEEGSVTNMFTSIVGNVFGF KALRALRLEDLRIPPAYVKTFQGPPHGIQVERDKLNKYGRPLLGCTIKPKLGLSAKNYGRAVYECL | |||
Physicochemical properties | |||
| Number of amino acids: | 186 | ||
| Molecular weight: | 20,620.317 | ||
| Theoretical pI: | 7.765 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 30370 30620 | ||
| Instability index: | 25.517 | ||
| aromaticity | 0.118 | ||
| GRAVY | -0.279 | ||
Secondary Structure Fraction | |||
| Helix | 0.323 | ||
| turn | 0.220 | ||
| sheet | 0.242 | ||