Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>MK090294.1 | internal | 186 | 558-1(-) |
Amino Acid sequence : | |||
KASVGFKAGVKEYKLTYYTPEYETKDTDILAAFRVTPQPGVPPEEAGAAVAAESSTGTWTTVWTDGLTSLDRYKGRCYXIEPVVGEKDQYICYVAYPLDLFEEGSVTNMFTSIVGNVFGF KALRALRLEDLRIPPAYVKTFQGPPHGIQVERDKLNKYGRPXLGCTIKPKLGLSAKXXXRXXXXCX | |||
Physicochemical properties | |||
Number of amino acids: | 186 | ||
Molecular weight: | 19,482.091 | ||
Theoretical pI: | 8.595 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 27390 27640 | ||
Instability index: | 24.654 | ||
aromaticity | 0.114 | ||
GRAVY | -0.295 | ||
Secondary Structure Fraction | |||
Helix | 0.313 | ||
turn | 0.222 | ||
sheet | 0.233 |